<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04567
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MMNNYGNMMMGEQFRKMESNYSPKSSPHGGRSPVVSRQDSSGTLKATISLGKTPTIIQTGPFYSLKEPPGKGELTGDKDLMTEYGLHHTLTKFKDKKVKESLASFLPNLPGIYDGMNNLENSTLRSVIDKPPIVGKELLPLSAVQLAGFRLHPGPLPEQYRALNTTPARKHKNKHKKHKHKDGQQPPETNLMDSSGLETYEKKHKKQKRHEDEKERKKRKKEKKRKKKSHSPEPPSSGGVSPMLGPTGTNTMLGPSGMPMQQGIVGGVAGGGGGGAGPGGMMGGNVGGGSGSLQGLSVGGANNPLGSGPGVTTMSGPGGMMMPQQASLF |
| Length | 329 |
| Position | Head |
| Organism | Lucilia cuprina (Green bottle fly) (Australian sheep blowfly) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Oestroidea>
Calliphoridae> Luciliinae> Lucilia.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.829 |
| Instability index | 49.90 |
| Isoelectric point | 9.94 |
| Molecular weight | 35001.71 |
| Publications | PubMed=26108605
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP04567
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.78| 14| 18| 283| 300| 1
---------------------------------------------------------------------------
266- 279 (28.10/ 6.79) GG.VAGGGGG..GAGPG
283- 299 (17.68/10.57) GGnVGGGSGSlqGLSVG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 70.57| 13| 19| 201| 213| 2
---------------------------------------------------------------------------
172- 183 (23.19/13.78) KNKHKKHK.HKDG
201- 213 (25.31/15.67) EKKHKKQKRHEDE
222- 233 (22.07/12.78) EKKRKK.KSHSPE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 84.12| 23| 60| 238| 262| 3
---------------------------------------------------------------------------
239- 262 (43.58/18.11) GVSPMLG..PtGTNTMLGPSGMPMQQ
300- 324 (40.54/10.67) GANNPLGsgP.GVTTMSGPGGMMMPQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.06| 16| 19| 30| 45| 5
---------------------------------------------------------------------------
30- 45 (26.59/16.29) GRSPVVSRQDSSGTLK
51- 66 (28.47/17.95) GKTPTIIQTGPFYSLK
---------------------------------------------------------------------------
|