<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04567

Description Mediator of RNA polymerase II transcription subunit 19
SequenceMMNNYGNMMMGEQFRKMESNYSPKSSPHGGRSPVVSRQDSSGTLKATISLGKTPTIIQTGPFYSLKEPPGKGELTGDKDLMTEYGLHHTLTKFKDKKVKESLASFLPNLPGIYDGMNNLENSTLRSVIDKPPIVGKELLPLSAVQLAGFRLHPGPLPEQYRALNTTPARKHKNKHKKHKHKDGQQPPETNLMDSSGLETYEKKHKKQKRHEDEKERKKRKKEKKRKKKSHSPEPPSSGGVSPMLGPTGTNTMLGPSGMPMQQGIVGGVAGGGGGGAGPGGMMGGNVGGGSGSLQGLSVGGANNPLGSGPGVTTMSGPGGMMMPQQASLF
Length329
PositionHead
OrganismLucilia cuprina (Green bottle fly) (Australian sheep blowfly)
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Oestroidea> Calliphoridae> Luciliinae> Lucilia.
Aromaticity0.04
Grand average of hydropathy-0.829
Instability index49.90
Isoelectric point9.94
Molecular weight35001.71
Publications
PubMed=26108605

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
ECO:0000256	RuleBase:RU364151
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions











Repeat regions





Repeats

>MDP04567
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      45.78|      14|      18|     283|     300|       1
---------------------------------------------------------------------------
  266-  279 (28.10/ 6.79)	GG.VAGGGGG..GAGPG
  283-  299 (17.68/10.57)	GGnVGGGSGSlqGLSVG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      70.57|      13|      19|     201|     213|       2
---------------------------------------------------------------------------
  172-  183 (23.19/13.78)	KNKHKKHK.HKDG
  201-  213 (25.31/15.67)	EKKHKKQKRHEDE
  222-  233 (22.07/12.78)	EKKRKK.KSHSPE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      84.12|      23|      60|     238|     262|       3
---------------------------------------------------------------------------
  239-  262 (43.58/18.11)	GVSPMLG..PtGTNTMLGPSGMPMQQ
  300-  324 (40.54/10.67)	GANNPLGsgP.GVTTMSGPGGMMMPQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      55.06|      16|      19|      30|      45|       5
---------------------------------------------------------------------------
   30-   45 (26.59/16.29)	GRSPVVSRQDSSGTLK
   51-   66 (28.47/17.95)	GKTPTIIQTGPFYSLK
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP04567 with Med19 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) EQFRKMESNYSPKSSPHGGRSPVVSRQDSSGTLKATISL
2) VQLAGFRLHPGPLPEQYRALNTTPARKHKNKHKKHKHKDGQQPPETNLMDSSGLETYEKKHKKQKRHEDEKERKKRKKEKKRKKKSHSPEPPSSGGVSPMLGPTGTNTMLGPSGMPMQQGIVGGVAGGGGGGAGPGGMMGGNVGGGSGSLQGLSVGGANNPLGSGPGVTTMSGPGGMMMPQQASLF
12
144
50
329










Molecular Recognition Features






MoRF SequenceStartStop




NANANA