<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04564
| Description |
Mediator of RNA polymerase II transcription subunit 31 (Fragment) |
| Sequence | ARKQTLPCNMAKMYGKGKTAIESEEQQKLRFQVELEFVQCLANPNYLNFLAQRGYFKDQAFINYLKYLQYWKEPEYAKYLMYPMCLYFLDLLQYEHFRREIVNSQCCKFIDDQAILQWQHYTRKRIKMFNSVNGNTQNQLNAAPNSDNMAEAQQPQMGAQQPQQQQQGQTNIAACNMQNGSMVNTGNTQQQTQLAGQQQTQQLNGNSAANVNQSNAGGAPLMQKM |
| Length | 225 |
| Position | Middle |
| Organism | Lucilia cuprina (Green bottle fly) (Australian sheep blowfly) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Oestroidea>
Calliphoridae> Luciliinae> Lucilia.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.797 |
| Instability index | 47.55 |
| Isoelectric point | 8.84 |
| Molecular weight | 25955.05 |
| Publications | PubMed=26108605
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP04564
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 76.98| 26| 29| 137| 165| 1
---------------------------------------------------------------------------
153- 182 (40.27/17.07) QQPQMGAQQPQQQ.......qQGQTNiA..ACNMQNgsM
190- 225 (36.71/10.27) QQTQLAGQQQTQQlngnsaanVNQSN.AggAPLMQK..M
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 95.04| 26| 29| 39| 67| 2
---------------------------------------------------------------------------
39- 67 (43.13/29.09) QCLANPNYLNFLAqrgYFKDQAFINYLKY
69- 94 (51.91/27.59) QYWKEPEYAKYLM...YPMCLYFLDLLQY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 32.63| 10| 25| 95| 104| 5
---------------------------------------------------------------------------
95- 104 (18.12/13.20) EHFRRE...IVNS
119- 131 (14.51/ 9.43) QHYTRKrikMFNS
---------------------------------------------------------------------------
|