Description | Mediator of RNA polymerase II transcription subunit 21 |
Sequence | MADRLTQLQDTVNMQAEHFCNAIGIIQQTSYPSKFPNFDRTGSQTPVQNQQQEDYAQLFAQLISRCAKDIDTLIESLPNEDSSTELQNQSLKRLELENQEAAERLEEIALKGELLLGKIQNALEDIAQAQLDMQITMKNNSSS |
Length | 143 |
Position | Middle |
Organism | Lucilia cuprina (Green bottle fly) (Australian sheep blowfly) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Oestroidea> Calliphoridae> Luciliinae> Lucilia. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.624 |
Instability index | 45.17 |
Isoelectric point | 4.38 |
Molecular weight | 16130.78 |
Publications | PubMed=26108605 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU366036 |
GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule |
GO - Biological Function | |
GO - Biological Process |
Binary Interactions |
Repeats | >MDP04558 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 50.35| 16| 16| 77| 92| 1 --------------------------------------------------------------------------- 77- 92 (26.15/15.88) LPNEDSSTELQNQSLK 96- 111 (24.20/14.23) LENQEAAERLEEIALK --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) DYAQL 2) LQNQSLKRLELEN | 54 86 | 58 98 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab