<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04546
Description |
Uncharacterized protein |
Sequence | MSTSSNVNGNLMDEFEEAFQNCLLSLTKLEANTGTNKEEVELEVQKTTNRFIDVARQMEAFFLQKRFLVSTLKPDQLIKDENQDLRTEISRKETLLNKHYSRLEEWKACLSDIQQNPAILNRPVGGLPAGLGEPGGSMIGPSGSGGPLGVGAMAAMGGPPGRGGMMPNVPGAMGPMSQMGAAGQQQQHLQNQKMLQAQQMQQLRMMGKLPK |
Length | 211 |
Position | Head |
Organism | Lucilia cuprina (Green bottle fly) (Australian sheep blowfly) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Oestroidea>
Calliphoridae> Luciliinae> Lucilia.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.510 |
Instability index | 53.02 |
Isoelectric point | 6.75 |
Molecular weight | 22972.14 |
Publications | PubMed=26108605
|
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP04546
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 74.77| 20| 23| 117| 136| 1
---------------------------------------------------------------------------
117- 136 (38.66/19.99) PAILNRPVG.GLPAGLGEPGG
141- 161 (36.11/18.20) PSGSGGPLGvGAMAAMGGPPG
---------------------------------------------------------------------------
|