<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04529
Description |
Mediator of RNA polymerase II transcription subunit 20 |
Sequence | MTVKWVLHWHPSAGHTVNTQIMNEISQCVESLNGVKDGRWKSVLTFYKPITRDQSMAAEYPRDFLGISIPEQPNKYYFIIRAHRIVLEADLSIQTIMDKLQSYKSRVSLNFEGIQYQLGDFQVRVGKVAPSTSETMRGIVMEVEYLPISSIDKSRQILEDFVDFWKDTLSKRSLPGHFLHNEPNFGEYGLGDQYSAEHTTVQYATVMAQLIATVQTTQVVRN |
Length | 222 |
Position | Head |
Organism | Spinacia oleracea (Spinach) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
Caryophyllales> Chenopodiaceae> Chenopodioideae> Anserineae> Spinacia.
|
Aromaticity | 0.10 |
Grand average of hydropathy | -0.308 |
Instability index | 28.95 |
Isoelectric point | 6.38 |
Molecular weight | 25465.69 |
Publications | PubMed=24352233
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364152
|
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coactivator activity GO:0003713 IBA:GO_Central
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP04529
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 110.45| 34| 122| 11| 44| 2
---------------------------------------------------------------------------
11- 44 (60.68/45.98) PSAGHTVNTQIMN....EISQCVESLNGVKD..GRWKSVL
130- 169 (49.78/36.53) PSTSETMRGIVMEveylPISSIDKSRQILEDfvDFWKDTL
---------------------------------------------------------------------------
|