<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04525
| Description |
Uncharacterized protein |
| Sequence | MLASVTLRLLGSRVVYEDIDPSHNPRRGSPLKESELQMETCADVSLDLSGKNLFDWLLLVLHALLSNSLSSWLRLKSSSKNTVLSTKDFAGFDREILENLQSDLDRMQLPDAIRWRIQAAMPILVPKPRTFISCQPPPLSSAVLASLQPSVLPSNQAGSLPKNQVSSVRTSTSAAMLGKSKSVALQPDNELEVDPWMLLEDGAGSGPSSSNTAVMGGGDHAILKASSWLKGAVRVRRTDLTYIGPVDDDS |
| Length | 250 |
| Position | Kinase |
| Organism | Spinacia oleracea (Spinach) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
Caryophyllales> Chenopodiaceae> Chenopodioideae> Anserineae> Spinacia.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.155 |
| Instability index | 49.95 |
| Isoelectric point | 5.94 |
| Molecular weight | 27062.58 |
| Publications | PubMed=24352233
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP04525
No repeats found
|