<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04516
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MASTDDADDKAKSPSSPKVVYKDPDDGRQRFLLELEFVQCLSNPTYIHYLAQNRYFEDEAFVGYLNYLQYWQRPEYLKFIMYPHCLYFLELLQNANFRNAMAHPGNKELAHRQQFYFWKNYRNNRLKHILPRPLPESAPDPPAPTAAPLRLPPAIPPTSGPSVAVPPMQFANAPGSVVAKNDTRNSGIDRRKRKKDG |
| Length | 197 |
| Position | Middle |
| Organism | Spinacia oleracea (Spinach) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
Caryophyllales> Chenopodiaceae> Chenopodioideae> Anserineae> Spinacia.
|
| Aromaticity | 0.12 |
| Grand average of hydropathy | -0.730 |
| Instability index | 51.64 |
| Isoelectric point | 9.26 |
| Molecular weight | 22696.52 |
| Publications | PubMed=24352233
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP04516
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.36| 16| 16| 134| 149| 1
---------------------------------------------------------------------------
134- 149 (30.61/15.10) LPESAPDPPAPTAA..PL
151- 168 (26.75/12.36) LPPAIPPTSGPSVAvpPM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 72.33| 20| 27| 31| 55| 2
---------------------------------------------------------------------------
31- 50 (35.62/14.09) FLLELEFVQCLSNPTYIHYL
61- 80 (36.71/21.17) FVGYLNYLQYWQRPEYLKFI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 58.00| 19| 26| 86| 104| 3
---------------------------------------------------------------------------
82- 102 (28.24/13.15) YP........hcLYFLELLQNANFRNAMA
103- 131 (29.76/14.14) HPgnkelahrqqFYFWKNYRNNRLKHILP
---------------------------------------------------------------------------
|