<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04508
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MLQSLPHQVVPSPARLGLSNPNSPALQSPSATKLSSQQATQSQQSHQQVTLPAAKTTSSTLLSLLPPQQRAQTLLVQMASLAAKLFEVSPNRSVWVSAFRGSLPTFLPSQTNSTSTPPLDSPSSTTKEIVALFTSLQTQLFEAVAELQEILDLQDAKQKLNQEIEAKDSAVLSFAKKLKEAERVLDMLVDDYADYRRPKRSKSEDDSDDTSSTTTTTTVASQLKLSDVLSYAHKISYTTFAPPEFGAGGPLRGALPPAPQEDQMRASQLYAFVDLDIGLPKTVEDEKRIEPLIETQNPDPMAAIKGLMPPNITVPAGWKPGMPVELPMDIPLPPAGWKPGDPINLPPLESLPMVARAGEQPPPQSVAPVFPRAAETIQVPHIRIDILDQDDDSDEYSSDEGSSDDEDEG |
| Length | 409 |
| Position | Middle |
| Organism | Spinacia oleracea (Spinach) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
Caryophyllales> Chenopodiaceae> Chenopodioideae> Anserineae> Spinacia.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.426 |
| Instability index | 72.22 |
| Isoelectric point | 4.58 |
| Molecular weight | 44272.27 |
| Publications | PubMed=24352233
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP04508
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 83.47| 16| 16| 312| 327| 1
---------------------------------------------------------------------------
312- 327 (33.36/18.39) ITV.PAGWKPGMPVELP
330- 346 (30.30/16.02) IPLpPAGWKPGDPINLP
364- 380 (19.81/ 7.91) QSVaPVFPRAAETIQVP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 165.10| 37| 54| 51| 87| 2
---------------------------------------------------------------------------
5- 36 (53.46/22.60) LPH...QVVPSPARLGLSNPNSPA....LQSPS.ATKLSS
51- 87 (57.82/24.98) LPA...AKTTSSTLLSLLPPQQRAQTLLVQMASLAAKLFE
103- 142 (53.82/22.80) LPTflpSQTNSTSTPPLDSPSSTTKEIVALFTSLQTQLFE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.10| 11| 51| 300| 310| 3
---------------------------------------------------------------------------
300- 310 (22.57/12.35) PMAAIKGLMPP
352- 362 (22.53/12.31) PMVARAGEQPP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 31.98| 12| 54| 167| 178| 4
---------------------------------------------------------------------------
175- 192 (12.82/ 6.27) AKKLkeaervLDMLVDDY
220- 231 (19.16/12.87) ASQL......KLSDVLSY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.05| 13| 21| 257| 269| 5
---------------------------------------------------------------------------
257- 269 (23.61/12.57) PAPQEDQMRASQL
280- 292 (22.44/11.63) PKTVEDEKRIEPL
---------------------------------------------------------------------------
|