<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04500
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MDSSNAADDTIDSPSSTKNVYKDPDDGRQRFLLELEFIQCLANPTYIHYLAQNRYFEDEAFIGYLKYLQYWQRPEYLKFIMYPHCLYFLELLQNANFRNAMAHPGNKELAHRQQFYFWKNYRNNRLKHILPRSLPEPGPEPPASTAAPPLLPPAVPPTSAPSPALSAMQYSIPPASGVAKNDTRNSGIDRRKRKKEG |
| Length | 197 |
| Position | Middle |
| Organism | Spinacia oleracea (Spinach) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
Caryophyllales> Chenopodiaceae> Chenopodioideae> Anserineae> Spinacia.
|
| Aromaticity | 0.12 |
| Grand average of hydropathy | -0.735 |
| Instability index | 57.93 |
| Isoelectric point | 8.97 |
| Molecular weight | 22678.41 |
| Publications | PubMed=24352233
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP04500
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 83.97| 19| 19| 46| 64| 1
---------------------------------------------------------------------------
28- 40 (15.86/ 6.06) ......RQRFLLELEFIQC
46- 64 (35.04/20.57) YIHYLAQNRYFEDEAFIGY
67- 82 (33.06/19.07) YLQYWQRPEYLK...FIMY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.73| 13| 15| 131| 143| 2
---------------------------------------------------------------------------
131- 143 (27.38/12.54) PRSLPEPGP....EPPA
148- 164 (21.35/ 8.35) PPLLPPAVPptsaPSPA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 47.49| 13| 26| 86| 98| 3
---------------------------------------------------------------------------
86- 98 (21.95/11.45) LYFLELLQNANFR
115- 127 (25.54/14.23) FYFWKNYRNNRLK
---------------------------------------------------------------------------
|