<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04487
Description |
Uncharacterized protein |
Sequence | MLLATTLTPTSYKFWWSLLVRVDWSEVVGCTQSAPGDGIERNQNMRK |
Length | 47 |
Position | Tail |
Organism | Spinacia oleracea (Spinach) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
Caryophyllales> Chenopodiaceae> Chenopodioideae> Anserineae> Spinacia.
|
Aromaticity | 0.11 |
Grand average of hydropathy | -0.243 |
Instability index | 34.62 |
Isoelectric point | 7.93 |
Molecular weight | 5387.13 |
Publications | PubMed=24352233
|
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP04487
No repeats found
No repeats found
|