<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04485
| Description |
Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MATATYPPPPPYYRLYKDYSQNPNSTPEPPPPIEGTYTCYGATYTTDDVMPSLEDQGVRQMYPKGPSIDFKKELKSLNRELQLHLLELADILVERPSQYARRVEEISVIFKNLHHLLNSLRPHQARATLIHILELQIQRRKQAVEDIKRRREEAQKLLKEALGTLEGQ |
| Length | 168 |
| Position | Middle |
| Organism | Spinacia oleracea (Spinach) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
Caryophyllales> Chenopodiaceae> Chenopodioideae> Anserineae> Spinacia.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.736 |
| Instability index | 65.35 |
| Isoelectric point | 7.84 |
| Molecular weight | 19465.02 |
| Publications | PubMed=24352233
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP04485
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.17| 12| 19| 8| 26| 1
---------------------------------------------------------------------------
8- 19 (27.50/21.18) PPPPYYRLYKDY
29- 40 (27.67/ 8.07) PPPPIEGTYTCY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.54| 17| 38| 67| 84| 2
---------------------------------------------------------------------------
67- 84 (24.51/21.99) SIDFkKELKSLNRELQLH
107- 123 (31.04/22.49) SVIF.KNLHHLLNSLRPH
---------------------------------------------------------------------------
|