<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04483
| Description |
Uncharacterized protein |
| Sequence | MNKGSGGGGPTAAAAAAAAQKQKALLQRVETDVSSLVDNFTVLVNVSRVNDPPVRNQQEAFMMEVRAARMVQAADSLLKLVSELKQTAIFSGLASLNDHVEQRIGEFNKLAEKTDITLGRVGEEAAATLKDLESHFYSSAEKAAQPSSP |
| Length | 149 |
| Position | Head |
| Organism | Spinacia oleracea (Spinach) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
Caryophyllales> Chenopodiaceae> Chenopodioideae> Anserineae> Spinacia.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.241 |
| Instability index | 38.22 |
| Isoelectric point | 5.70 |
| Molecular weight | 15826.66 |
| Publications | PubMed=24352233
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP04483
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 47.45| 14| 14| 93| 106| 1
---------------------------------------------------------------------------
93- 106 (24.17/15.32) LASLNDHVEQRIGE
110- 123 (23.28/14.58) LAEKTDITLGRVGE
---------------------------------------------------------------------------
|