<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04478
| Description |
Uncharacterized protein |
| Sequence | MNDELCSPTLWSTTTSYPSVIPGTSTPITITGNGHSEGSNGDVSLDSTHQFYMGGGTLEQARLRYKSSVASLRVVLNAMLQNHKEDVDGSVSKEDEAEIEKLEDQVSSLRMHMVMLKLNYC |
| Length | 121 |
| Position | Head |
| Organism | Spinacia oleracea (Spinach) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
Caryophyllales> Chenopodiaceae> Chenopodioideae> Anserineae> Spinacia.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.408 |
| Instability index | 47.85 |
| Isoelectric point | 4.89 |
| Molecular weight | 13269.70 |
| Publications | PubMed=24352233
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP04478
No repeats found
No repeats found
|