<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04459
| Description |
Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MATSSSFPPPPPFYKLYKDVNSGPPPPPPTGSTYTCFGATHTNEHNVLPSLEEQGIRQIYPKGPDIDHKKELRELNHKLQHYYVELSDLLIDRLSLLADRMNEITTIIANINHLLNSLRPRQALDITVDVLELQIERRKNAIEDIKGRRKLAQNMIKEAMEKLEADQTAIEMAKTYVIRSV |
| Length | 181 |
| Position | Middle |
| Organism | Zostera marina (Eelgrass) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Zosteraceae> Zostera.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.536 |
| Instability index | 58.44 |
| Isoelectric point | 6.60 |
| Molecular weight | 20654.46 |
| Publications | PubMed=26814964
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP04459
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 59.36| 13| 15| 5| 17| 1
---------------------------------------------------------------------------
5- 17 (29.57/15.27) SSFPPPPPFYKLY
22- 34 (29.78/15.41) SGPPPPPPTGSTY
---------------------------------------------------------------------------
|