<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04458
Description |
Mediator of RNA polymerase II transcription subunit 18 |
Sequence | MECTMQGVIETQHVEALETLLNGLCAVPKERVRVHEFFLKSGPNLGSVSSELQLLCDIGQSTPSWIVRHIGGVMRGPGADQLSVVVRTMVQSSISKNALRFFYYLGYKLEYETLKTGFAFNFQRGSAKISITVITVNKIPKLHAIDEAVPVTPGMQLVQVTAPATADNYGEVAASITSFCDHLSPLLYLSKPSNTTGIVPTAEATAASLMSNTGMKTF |
Length | 218 |
Position | Head |
Organism | Zostera marina (Eelgrass) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Zosteraceae> Zostera.
|
Aromaticity | 0.07 |
Grand average of hydropathy | 0.139 |
Instability index | 31.35 |
Isoelectric point | 6.95 |
Molecular weight | 23571.96 |
Publications | PubMed=26814964
|
Function
Annotated function |
|
GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
termination of RNA polymerase II transcription GO:0006369 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP04458
No repeats found
|