<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04449
Description |
Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MEELTAGGNQGARNDLNDISPPPGTDMTGICFKDQLWLNTYPLDRNLVFEYFALSQFYDSTCNNELLRSQSIHPLDISHLSKMTGSEYMLTDVREPNLFVIRKQNRDGPEKVTPQLTYYILDGCIYQAPQLCNVFYSRIGRVLHNLTQGLKTVASKLEKINSDDSDEEGVDEELTSTKEPINVKELKRVDHILTSLLHKLPPAPPAPDFARGYGPLSTLDEREKEKDESKLSNDTLFCSDPIINHGPSKRMKF |
Length | 253 |
Position | Head |
Organism | Zostera marina (Eelgrass) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Zosteraceae> Zostera.
|
Aromaticity | 0.08 |
Grand average of hydropathy | -0.592 |
Instability index | 45.69 |
Isoelectric point | 5.12 |
Molecular weight | 28652.00 |
Publications | PubMed=26814964
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143
|
GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coactivator activity GO:0003713 IBA:GO_Central
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP04449
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.56| 15| 18| 160| 176| 1
---------------------------------------------------------------------------
160- 176 (20.39/17.37) INSddSDEEGVDEELTS
181- 195 (25.17/14.21) INV..KELKRVDHILTS
---------------------------------------------------------------------------
|