<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04438
Description |
Mediator of RNA polymerase II transcription subunit 20 |
Sequence | MATVKIVINKIRQSKNREGAESGAMPVKWLLHWKNISNLDKKMAEDILSEMLKSIERMYAVKEGPWKNTLSFFHPNLKDLKKPTVCASECLGLSLYEDPEKFFFVLFPPKLVVEVDSNYSLLMNHLGSYKKGNFIHFEGTRYRCGDFRLRLGFASSVSLRIKAVFMEIEYLPISSIKTAEPIMEGFISLLKLLMSQTGIPGNFVCHDPKYAEFELPDQYSSMHTALQYSYLMTQLI |
Length | 236 |
Position | Head |
Organism | Zostera marina (Eelgrass) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Zosteraceae> Zostera.
|
Aromaticity | 0.11 |
Grand average of hydropathy | -0.106 |
Instability index | 39.88 |
Isoelectric point | 8.74 |
Molecular weight | 27110.44 |
Publications | PubMed=26814964
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364152
|
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coactivator activity GO:0003713 IBA:GO_Central
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP04438
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 89.58| 26| 98| 104| 129| 1
---------------------------------------------------------------------------
104- 129 (47.42/28.40) FVLFPPKLV.VEVDSNYSLLMNHLG.SY
203- 230 (42.17/24.61) FVCHDPKYAeFELPDQYSSMHTALQySY
---------------------------------------------------------------------------
|