<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04433
Description |
Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MSTSAAYPPPPPFYKLYKDAKSGPDPPPPLPKGATYTLFGATYTTDDVLPSLEEQGVRQLYPKDSNIDYKKELRALNRDLQLNFLELADVLVERPSQYAQRIEEISTIFKNMHHLLNCLRPLQAQATLIHLLELQIERRKQAIEDIKMRRKEAQRMLKEAMEMLDG |
Length | 166 |
Position | Middle |
Organism | Zostera marina (Eelgrass) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Zosteraceae> Zostera.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.589 |
Instability index | 71.09 |
Isoelectric point | 6.84 |
Molecular weight | 19139.88 |
Publications | PubMed=26814964
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 RuleBase:RU364060
|
GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP04433
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 62.72| 17| 20| 14| 32| 2
---------------------------------------------------------------------------
14- 30 (32.88/18.48) YKLYKDAKSGPDPPPPL
36- 52 (29.84/10.74) YTLFGATYTTDDVLPSL
---------------------------------------------------------------------------
|