<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04422
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MVSLISGSPQAFETFKEPDDGRQRLLIELEFVQCLANPIYIHHLAQNQYFEDEAFVRYLKYLQYWQKPQYITLIMYPHCLYFLELLQNERFRSAMAHPNYKELVHQQQFYFWKHHKKNRLNYILTSNHSESAPKPPVVPPSPAAPATVPSESVPAKSVPAKSVSAESIPTESIPAESVPAESVPAESIPAESVPRPAHSPMQMQMQMQMPELIDLTDIGDEEMSELSD |
| Length | 228 |
| Position | Middle |
| Organism | Zostera marina (Eelgrass) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Zosteraceae> Zostera.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.423 |
| Instability index | 64.87 |
| Isoelectric point | 5.25 |
| Molecular weight | 26069.37 |
| Publications | PubMed=26814964
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP04422
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 100.83| 19| 19| 151| 169| 1
---------------------------------------------------------------------------
130- 149 (29.26/13.23) ESAPKPPvVPPSPAAPATVP
151- 169 (35.47/17.46) ESVPAKS.VPAKSVSAESIP
171- 189 (36.10/17.90) ESIPAES.VPAESVPAESIP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 50.48| 13| 27| 29| 41| 2
---------------------------------------------------------------------------
29- 41 (24.50/13.07) LEFVQCLANPIYI
59- 71 (25.98/14.19) LKYLQYWQKPQYI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.16| 17| 20| 84| 100| 3
---------------------------------------------------------------------------
84- 100 (31.02/21.62) ELLQNERFRSAMAHP....NY
102- 122 (29.13/19.90) ELVHQQQFYFWKHHKknrlNY
---------------------------------------------------------------------------
|