<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04409

Description Mediator of RNA polymerase II transcription subunit 8
SequenceMATESDVAANQVVIERLNPAVQQQLNLDSVKTRALGLYKAISRVLEEFDAIGRANAIPKWKDVLSQFSMVNLELFNIFEDIKKVSKAFVVNPKLVNAQNASILPVMLSSKLLPEMELEDDLKREQLLHGMKSFSMTTQIDKLNNRIEMIRKCCESAEKIIADSRKAYGLGSRQLQGVSLLPFLDKTQLTKIHEQEVLLRNTVNFGEGLRLPADQRQMISSFPSHPLPAHLSDILTQIEDLPGLGENSNSHQRNTPLSMSSGSITNQGTGTQLIGKSVPSPSGATGTPSMDNVSTPPLPYTNSPRSNVSMMNTPSPQQQQHILQQQQQQQRRLNPLQQHHQQLLVQQQQQQLRQQSSSTLLGQVPGQHQIQQYSQPLSQQQFHNRQLQAGHTQSNIGQTQINQANQLRTHLSPFNGNTANSMLNAAAQTSQNPQMISNMHSTIPRMQQYGLTSGHSQRNYASQMLNDQMFNIGASNSSNMVALQQQQLGGQIASGNMQGNNQNLQAVGMPSLQNTTSQNPNFQQQRPPNQQ
Length530
PositionHead
OrganismZostera marina (Eelgrass)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Zosteraceae> Zostera.
Aromaticity0.04
Grand average of hydropathy-0.640
Instability index57.26
Isoelectric point9.37
Molecular weight58873.61
Publications
PubMed=26814964

Function

Annotated function 
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP04409
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      47.79|      15|      15|     472|     486|       2
---------------------------------------------------------------------------
  472-  486 (25.71/ 9.02)	GASNSSNMVALQQQ.Q
  489-  504 (22.08/ 6.86)	GQIASGNMQGNNQNlQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      77.03|      26|      42|      21|      48|       3
---------------------------------------------------------------------------
   21-   48 (35.59/35.58)	VQQQLNLdsVKTRALGLYKAISRVLEEF
   63-   88 (41.44/33.00)	VLSQFSM..VNLELFNIFEDIKKVSKAF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     130.14|      32|      75|      98|     129|       4
---------------------------------------------------------------------------
   98-  129 (52.26/29.81)	QNASI.......LPVMLSSKL.....LPEM.ELEDDLKREQLLHG
  175-  205 (48.59/27.24)	QGVSL.......LP.FLDKTQ.....LTKI.HEQEVLLRNTVNFG
  214-  256 (29.29/13.72)	QRQMIssfpshpLPAHLSDILtqiedLPGLgENSNSHQRNTPL..
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      71.44|      21|      85|     418|     447|       5
---------------------------------------------------------------------------
  420-  447 (30.68/26.94)	SMLNaaaQTSQNPqmisNMHSTIPRMQQ
  510-  530 (40.75/14.56)	SLQN...TTSQNP....NFQQQRPPNQQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      79.53|      21|      85|     361|     381|       7
---------------------------------------------------------------------------
  361-  381 (40.89/18.89)	GQVPGQHQIQQYSQPLSQQQF
  449-  469 (38.65/17.45)	GLTSGHSQRNYASQMLNDQMF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      38.75|      12|      15|     268|     280|       8
---------------------------------------------------------------------------
  268-  280 (18.45/16.50)	TGTQLIGK.SVPsP
  284-  296 (20.30/12.34)	TGTPSMDNvSTP.P
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP04409 with Med8 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) HLSDILTQIEDLPGLGENSNSHQRNTPLSMSSGSITNQGTGTQLIGKSVPSPSGATGTPSMDNVSTPPLPYTNSPRSNVSMMNTPSPQQQQHILQQQQQQQRRLNPLQQHHQQLLVQQQQQQLRQQSSSTLLGQVPGQHQIQQYSQPLSQQQFHNRQLQAGHTQSNIGQTQINQANQLRTHLSPFNGNTANSMLNAAAQTSQNPQMISNMHSTIPRMQQYGLTSGHSQRNYASQMLNDQMFNIGASNSSNMVALQQQQLGGQIASGNMQGNNQNLQAVGMPSLQNTTSQNPNFQQQRPPNQQ
229
530










Molecular Recognition Features






MoRF SequenceStartStop




NANANA