<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04384

Description Mediator of RNA polymerase II transcription subunit 19
SequenceMATHSSPLESHPRFTNPWNEQSVKSSQQTEAAPDGRIAHTLTACTRCRQCTIPRTYIISLREKARTLEKELADLEKDIQHAADAELMVRGAGRIRFKENDESRYLGPSSGIAITRLVMEMAKQNTDSKSIKDVVPEFTAQEIKAAFALESSKPTSKVYPMISSIPQPNLPPRNLTYRLIDVFVVKAQAMLPTLHEPSFRQEVEQVFNGSDDPCLNFQLRMVIAISMQKMSTEYAGLADSYYLAALPYLEASLRRMDLRALQCLVLIAQYSLLTPTRTAAYWVVGMAVKLCQDLGLTEEATVTKSPDGRLLNPLEVDMRRRLFWIVTSMELGLAHSLGRPSCYSVPHDYINVKFFELVDDRYITADGILPGGTPILAKCIAIHFFKMRLLQLEIRRTLYLNKCDTPANDQDPWFSQMLAKLDHWVASCPKNDGGSGLSEKWFHGRRNTMIVFMFRPSPQVPEPSVEAARKCYEASVFNVAMQREQIATGSVDLTWIFTQSLFMALNTILWSLSYPDIRREHPIEEVRAHLDVALEAMMLAAERWPGVESALLLYKNLVTACLKAYNTDESFVVHSPSNHATPSSTQDVMTPPSISSPSIGTVSRGHSADPTFPYSQASPAAAVRAESQKPPSYSQWETEPPPLQSSDSNSTQASYTPQGYTESSTVFSDVTFNPTTPFNSFPSVVPGLPGWDPNFTVASTTASHLTYVDAAVDPMRWMDTIDDQYSQYFNGAFPIPPWRGRTLSQQEQIELMASLEENIPDVSAQLTPTSPPLMSVSASNYATNIASSQPPSQATSQPANLSSPPSSAPMSTQTSQQPTVGATNSFPTPASSVSGHFIGPTSVEDSEHAGTSFEHVQADSGTTTASGLHSSSTQQSEHRRTDHDREVEGPTPGIDVRDFASMGVPHTRSDTDAMDVDKDGNASSKSDGLSLESLQQDFSSAFHLCKSSHIATGPDPALDLISLYGLGPVAKSVARMDPVTGEKINRLRKSYEGKLKGLGLAGRNKPVKHDPSAPGGLRHLTMWPEEEWQNQKVYGKEIKVADIDSALHNLQMKAMQMEPGTVPNNEYWEDVLGHEKPSKHAGHGDGKKAATIPNTARSPSQANETPLATEPDRARPSRGRKRHYDDNSFVGYGEGYADDDDDTAFYSNSEGLGKKKRKKVRSHAIWDGSWTRLIVLVFLKEHVSKVSTPLPDRGGSYGVGMFGIGAR
Length1206
PositionHead
OrganismAspergillus udagawae
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus.
Aromaticity0.08
Grand average of hydropathy-0.445
Instability index46.67
Isoelectric point5.93
Molecular weight132829.88
Publications









Function






Annotated function


GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
DNA binding	GO:0003677	IEA:InterPro
transcription coregulator activity	GO:0003712	IEA:InterPro
zinc ion binding	GO:0008270	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro
transcription, DNA-templated	GO:0006351	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP04384
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|      99.24|      16|      18|     603|     618|       1
---------------------------------------------------------------------------
  562-  575 (21.54/ 7.80)	KAYNTDESFVVH....SP
  581-  596 (26.18/11.05)	PSSTQDVMTPPSI..SSP
  603-  618 (30.58/14.15)	RGHSADPTFPYSQ..ASP
  623-  639 (20.93/ 7.37)	RAESQKPP.SYSQweTEP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      55.31|      18|      21|     751|     771|       2
---------------------------------------------------------------------------
  751-  771 (25.03/22.58)	MASLEENipdVSAQLTPTSPP
  773-  790 (30.28/17.35)	MSVSASN...YATNIASSQPP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     392.93|      98|     172|     159|     256|       3
---------------------------------------------------------------------------
  159-  241 (130.59/82.91)	................................PMI..SSIPQPNLPPRNLTYRLIDVFVVKAQAMLPTL......HEPS.FR..QEVE.QVFNGSDDPCLNFQLRMVIAISMQKMS.......................................TEYAGLADSYY
  242-  306 (21.98/ 7.19)	LAALPYLEASLRRMD.....................................................................................................lralqclvliaqyslltptrtaaywvvgmavklcqdlglTEEATVTKSPD
  307-  413 (127.27/80.59)	GRLLNPLEVDMRRRLfwivtsmelglahslgrPSC..YSVPHDYINVK..FFELVDDRYITADGILPG.......GTPI.LA..KCIAiHFFKM...RLLQLEIRR..TLYLNKCD.......................................TP.ANDQDPWF
  417-  513 (113.10/70.72)	LAKLDHWVASCPKND....................ggSGLSEKWFHGRRNTM.IVFMFRPSPQVPEPSVeaarkcYEASvFNvaMQRE.QIATGSVDLTWIFTQSLFMALNTILWS.......................................LSY........
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     205.52|      58|      60|     810|     867|       4
---------------------------------------------------------------------------
  646-  669 (29.75/10.84)	DSN..........STQASYT...........PQ.G......YTES.STVFSDV.........................
  801-  857 (96.92/53.12)	.SSPPSSAPM...STQTSQQ...........PTVG......ATNSFPTPASSVSGHFIGPTSVEDSEHAGTSFEHVQA
  858-  935 (78.85/41.74)	DSGTTTASGLhssSTQQSEHrrtdhdrevegPTPGidvrdfASMGVPHTRSDTDAMDVDKDGNASSKSDGLSLESLQQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     102.03|      30|      31|     962|     991|       5
---------------------------------------------------------------------------
  962-  991 (51.29/30.56)	LYGLGPVAKS.VARMDPVTGEKINRLRKSYE
  994- 1024 (50.74/30.15)	LKGLGLAGRNkPVKHDPSAPGGLRHLTMWPE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      49.93|      16|      20|     706|     723|       6
---------------------------------------------------------------------------
  706-  723 (26.57/22.56)	YVDAA..VDPmrWMD.TIDDQ
  727-  745 (23.37/12.12)	YFNGAfpIPP..WRGrTLSQQ
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP04384 with Med19 domain of Kingdom Fungi
Unable to open file!