<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04381
| Description |
Uncharacterized protein |
| Sequence | MIVPNILVAYINLRLGSSNDAVKVESVTVTGIREQRTTSEFAVFRSLSQHLFRTLAQNEDTDVLDLLSLILSYHNLYTAKCAKCNSIHSSQDNTPAVIRTWVESDSSQWVLQCHHESCSPL |
| Length | 121 |
| Position | Tail |
| Organism | Rhizoctonia solani |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Cantharellales> Ceratobasidiaceae> Rhizoctonia.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.073 |
| Instability index | 52.77 |
| Isoelectric point | 5.89 |
| Molecular weight | 13578.19 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP04381
No repeats found
No repeats found
|