<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04369
| Description |
Uncharacterized protein |
| Sequence | MSANFYLSSHANHHLHPRYALLTARLDDLRHANEQELAWIEIWSASAMQKICKRLNLRQQVVATAVVYFRRFYLRNSYCETDPALVAAACCYVAAKAEETPVHVKSAVGEAKVVFNDMGLVSFTSDHHRLAEMEFYLLEELDFHLIIFHPYRALIQLCGRDGGANAAGEEGRLNKDKMLEMDDTTLQMSWCVSVRSFSQFVKLTIFGMCAVVSEHRFIINDTFRSSLCLVHPPHLIAVAAIYLAFALQPPASAAAQILPPSASASSGRSADASRPGGPATRTRRQSQDASNNPSSALTTTTSSGPKSSSSAAPDPITFLASLAIDQSLVLEIVQEIVSLYELWAQLESGSATGSGSSSSSRGGSSSSSMRGQSGSTNASPDEKVVAILRRMQEGRMRELRDERGKQVQAQQAQAAVAGRRGGGLTYGPNTSSRLPRRLEQHGDRANSLPPPPPAVIPLVLRSNVFSSDSRLRYSCTVNTLMTRSRRNSPSQQSTDDKAILGRKKRLLEDDFRSAGSPFLGRVSPSSERGSARGELPVRRLG |
| Length | 541 |
| Position | Kinase |
| Organism | Rhodosporidium toruloides (Yeast) (Rhodotorula gracilis) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Pucciniomycotina>
Microbotryomycetes> Sporidiobolales> Sporidiobolaceae> Rhodotorula.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.300 |
| Instability index | 64.22 |
| Isoelectric point | 9.34 |
| Molecular weight | 58965.98 |
| Publications | PubMed=29521624
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP04369
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 83.44| 29| 69| 272| 314| 1
---------------------------------------------------------------------------
272- 314 (39.84/38.37) ASRPGGPATrtrrqSQDASnnpssalttTTSSGPKSSSS.........AAPD
344- 381 (43.60/18.29) AQLESGSAT.....GSGSS.........SSSRGGSSSSSmrgqsgstnASPD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.14| 16| 16| 200| 215| 3
---------------------------------------------------------------------------
200- 215 (28.79/17.86) FVKLTIF..GMCAVVSEH
217- 234 (26.35/15.82) FIINDTFrsSLCLVHPPH
---------------------------------------------------------------------------
|