Description | BY PROTMAP: gi|472581896|gb|EMS19604.1| cyclin-dependent protein kinase [Rhodosporidium toruloides NP11] gi|647394942|emb|CDR36177.1| RHTO0S01e15940g1_1 [Rhodosporidium toruloides] |
Sequence | MPPQSPFPAYIQTPHDLYKSKRDFQRPTVLSRYSILGFLSSGTYGRVYKARVRQHTSDASPAGLLGTPSAATPGKRLKLSRDEGDDEGELVAIKKFKPDKEGEVVTYTGISQSACREIMINREISHENVTALREVMLEEKSIYLVFEYAEHDFLQIIHHHSSTRTQLPLGVLKSLLWQLFNGVSYLHDNWIIHRDLKPANILVTEKGQVKIGDLGLARLYQEPLQSLYTSDKIVVTVWYRSPELLLGARHYTPAIDMWSMGCIYGELLGLRPMFKGEEAKIELGAKKGGVPFQRDQLTRVIEVLGSINPKDWPSVMQLPEYPQLSRLDRYQDCLSQWFNGRLPRGAPPSLAYDLMRQLLAYDPTRRITARAALCHAWWGQDPKPHANAFTHLPPAASYPLRRVAHDDSDPKMQHNTLNKYAYTASGGNLGMAGNLSGSGAGGGRKRGRD |
Length | 449 |
Position | Kinase |
Organism | Rhodosporidium toruloides (Yeast) (Rhodotorula gracilis) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Pucciniomycotina> Microbotryomycetes> Sporidiobolales> Sporidiobolaceae> Rhodotorula. |
Aromaticity | 0.09 |
Grand average of hydropathy | -0.454 |
Instability index | 45.77 |
Isoelectric point | 9.22 |
Molecular weight | 50478.08 |
Publications | PubMed=29521624 |
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | ATP binding GO:0005524 IEA:InterPro protein kinase activity GO:0004672 IEA:InterPro |
GO - Biological Process |
Binary Interactions |
Repeats | >MDP04368 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 80.11| 26| 27| 25| 51| 2 --------------------------------------------------------------------------- 18- 46 (37.95/22.56) YKSkRdfQRPTVLSRYSILGFLSSGTYGR 48- 75 (42.16/21.29) YKA.RvrQHTSDASPAGLLGTPSAATPGK --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) GRKRGRD 2) PFPAYIQTPH 3) RLKLSR | 443 6 76 | 449 15 81 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab