<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04358
Description |
Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MASHPVGVSPFPQPPEYARQYTDANVAKKNVLPPPPVPSEFTVFGEEYNFEEEMIRSLQSQKMQQLFSSNGDWRSELKKLNRSTVAAFLDLLDILIRCPNHPERLEKINNLRLLFINMHHLINEYRPVQARDALQSMMRLLIKTIEDVTSRFRTYLAMGHEALNQVIDEVPPVLSASPMLNVEDVNVGVSIEQQVGAVETEISKRRSSYDEARKTTVSRREAWRRDVMLCELLDNMGDADLERRLSPSTSRVQMEY |
Length | 256 |
Position | Middle |
Organism | Brugia malayi (Filarial nematode worm) |
Kingdom | Metazoa |
Lineage | |
Aromaticity | 0.07 |
Grand average of hydropathy | -0.469 |
Instability index | 73.05 |
Isoelectric point | 5.66 |
Molecular weight | 29460.29 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP04358
No repeats found
|