Description | Mediator of RNA polymerase II transcription subunit 10 |
Sequence | MDPSLMGSMSNAPILQETATDTRYNHLEQTLENFQENARQMGVIASDFSTRSQEPLNQKIHTLISGLHELDHLKNQFMDVKIPLELLEYLDQGKNPQLYTKECLERTLNKNKEMNGKIEMYKKFRAMLLKELGEEMPNDMVLYRNLRDRKDASPQHENCNEDASD |
Length | 165 |
Position | Middle |
Organism | Brugia malayi (Filarial nematode worm) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida> Spirurina> Spiruromorpha> Filarioidea> Onchocercidae> Brugia. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.888 |
Instability index | 40.95 |
Isoelectric point | 5.17 |
Molecular weight | 19218.53 |
Publications | PubMed=17885136 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP04357 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 50.33| 14| 21| 112| 125| 3 --------------------------------------------------------------------------- 112- 125 (25.03/16.27) KEMNGKIEMYKKFR 134- 147 (25.31/16.52) EEMPNDMVLYRNLR --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) MVLYRNLRDRK 2) RAMLLKEL | 140 125 | 150 132 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab