| Description | Mediator of RNA polymerase II transcription subunit 11 |
| Sequence | MSNLSTSSGSELAWRLKAIGDVEQKIAELIRHAQTCINELSKEKQISKSKMEEASSAFKKCLNSIESDLSAQMQYLSHVCVGTAHQGSTFASQQNIALAEQTLVSLKDRLSAIQHIYLPVITDVSTTR |
| Length | 128 |
| Position | Head |
| Organism | Brugia malayi (Filarial nematode worm) |
| Kingdom | Metazoa |
| Lineage | |
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.218 |
| Instability index | 42.10 |
| Isoelectric point | 6.90 |
| Molecular weight | 14053.83 |
| Publications |
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process |
| Binary Interactions |
| Repeats | >MDP04356 No repeats found No repeats found |
| MoRF Sequence | Start | Stop |
| 1) SSAFKKCLN 2) VITDVSTTR | 55 120 | 63 128 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab