<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04337
Description |
Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MEVDEIQPKNPVTIALINETVPTHLTENTLLTTNIDDSNNVSKYNESKKIELAKKLREENKKVGDKFPGFYGVMKKPPNKQKLLGSDDILSIYNLRECFDKVCGKVNEGDSIYSILDEVIGPLENETYKSDSSSLRKLIERPPIVDKEIINFTDQMLKFYDLQPGALDKKYQLEGNAKEIASRYAMECSVNGAKDKSGTNGSYNGVPSINFEMYEKLDSGVRLKKKNRTKEEKEERARRKAERKEKRRLEAEKERFEELNMIKKAKKEEKYIESEKSFTIQTEQEDNEEEIIR |
Length | 293 |
Position | Head |
Organism | Strongyloides venezuelensis (Threadworm) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Tylenchina> Panagrolaimomorpha> Strongyloidoidea> Strongyloididae>
Strongyloides.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.997 |
Instability index | 49.71 |
Isoelectric point | 5.92 |
Molecular weight | 33879.98 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP04337
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 120.84| 39| 41| 56| 96| 1
---------------------------------------------------------------------------
56- 96 (59.14/33.33) LREENKKvGDKfPGFYGVMKKPP..NKQKLLGSDDILSIYNLR
123- 163 (61.70/27.95) LENETYK.SDS.SSLRKLIERPPivDKEIINFTDQMLKFYDLQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 74.65| 17| 41| 212| 228| 2
---------------------------------------------------------------------------
212- 228 (26.25/13.43) EMYEKLDSGVRLKKKNR
232- 248 (24.01/11.75) EKEERARRKAERKEKRR
254- 270 (24.39/12.03) ERFEELNMIKKAKKEEK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.95| 17| 24| 165| 182| 3
---------------------------------------------------------------------------
165- 182 (23.30/19.07) GALDKKyQLEGNAKEIAS
192- 208 (30.65/19.37) GAKDKS.GTNGSYNGVPS
---------------------------------------------------------------------------
|