<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04326
Description |
Cyclin-C (inferred by orthology to a C. elegans protein) |
Sequence | MAFTFWSSSHFKTWIIDPSCDYSIHRLHDVRLLGEENYEKVMIFFSNFIQTLGMDVLQSMGKIRMQVIATAIVYLRRFYSKRSFRDIDPFLLAPTCLYLACKSEEHGILHSSKLVLSANNALRKWPFLNKDIIINMNLIQEAEFYLLEIMDCSLIVFHPYRSLVPIIEDAKEFFKEQKEGCPFKDDKEWDGLVAETTKIINDSYRCDVPLKYAPHQIALGCMLLALINLKKETSFEDYYEAVDTDKEVIGDVVNELCGMYEIWKNFNEKEELKKIFEKIPRPNSNRQPYQSEIHESNSKNQFKF |
Length | 304 |
Position | Kinase |
Organism | Strongyloides venezuelensis (Threadworm) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Tylenchina> Panagrolaimomorpha> Strongyloidoidea> Strongyloididae>
Strongyloides.
|
Aromaticity | 0.12 |
Grand average of hydropathy | -0.254 |
Instability index | 40.97 |
Isoelectric point | 5.70 |
Molecular weight | 35739.84 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP04326
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.51| 12| 43| 155| 166| 1
---------------------------------------------------------------------------
155- 166 (23.18/13.42) IVFHPYRSLVPI
199- 210 (23.33/13.55) IINDSYRCDVPL
---------------------------------------------------------------------------
|