<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04325
| Description |
Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MDQNQGTISVSPFPFPPEYAHEYTTENIKSGRFRYPPPIPKKYKLFGIDYDRDNDKEPSLLDLKIPQLYNSKEDIKKELKKLNMSMIAAYLDLLDVLIHCPSDPERIQRIEQLRLLFINFHHLCNQLRPIQARDNLVAICEDQVIDIVRVAESLRQIVKLGKSDTYDLFKKYVKALKDKKDRYYKKKKSLIRGKKLEQKQQKMVGEINYPSTDINNIENIDEVGYLNNEVNTNETCDNDMIFSISSGVGNVNTSEHHGKESSLIFNRDEQLANIFNSLDIF |
| Length | 281 |
| Position | Middle |
| Organism | Strongyloides venezuelensis (Threadworm) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Tylenchina> Panagrolaimomorpha> Strongyloidoidea> Strongyloididae>
Strongyloides.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.643 |
| Instability index | 37.83 |
| Isoelectric point | 6.61 |
| Molecular weight | 32705.95 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP04325
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 47.76| 11| 19| 13| 28| 1
---------------------------------------------------------------------------
13- 23 (23.97/19.00) FPFPPEYAHEY
33- 43 (23.79/ 7.72) FRYPPPIPKKY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.68| 15| 19| 204| 222| 2
---------------------------------------------------------------------------
208- 222 (26.44/21.25) NYPSTDINNIENIDE
224- 238 (27.24/11.46) GYLNNEVNTNETCDN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 50.34| 15| 21| 240| 254| 4
---------------------------------------------------------------------------
240- 254 (25.16/16.03) MIFSISSGVGNVNTS
263- 277 (25.18/16.05) LIFNRDEQLANIFNS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 61.90| 18| 21| 91| 108| 5
---------------------------------------------------------------------------
91- 108 (32.94/23.08) LDLLDVLIHCPSDPER.IQ
113- 131 (28.97/19.51) LRLLFINFHHLCNQLRpIQ
---------------------------------------------------------------------------
|