Description | Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MDQNQGTISVSPFPFPPEYAHEYTTENIKSGRFRYPPPIPKKYKLFGIDYDRDNDKEPSLLDLKIPQLYNSKEDIKKELKKLNMSMIAAYLDLLDVLIHCPSDPERIQRIEQLRLLFINFHHLCNQLRPIQARDNLVAICEDQVIDIVRVAESLRQIVKLGKSDTYDLFKKYVKALKDKKDRYYKKKKSLIRGKKLEQKQQKMVGEINYPSTDINNIENIDEVGYLNNEVNTNETCDNDMIFSISSGVGNVNTSEHHGKESSLIFNRDEQLANIFNSLDIF |
Length | 281 |
Position | Middle |
Organism | Strongyloides venezuelensis (Threadworm) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida> Tylenchina> Panagrolaimomorpha> Strongyloidoidea> Strongyloididae> Strongyloides. |
Aromaticity | 0.09 |
Grand average of hydropathy | -0.643 |
Instability index | 37.83 |
Isoelectric point | 6.61 |
Molecular weight | 32705.95 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 RuleBase:RU364060 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP04325 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 47.76| 11| 19| 13| 28| 1 --------------------------------------------------------------------------- 13- 23 (23.97/19.00) FPFPPEYAHEY 33- 43 (23.79/ 7.72) FRYPPPIPKKY --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 53.68| 15| 19| 204| 222| 2 --------------------------------------------------------------------------- 208- 222 (26.44/21.25) NYPSTDINNIENIDE 224- 238 (27.24/11.46) GYLNNEVNTNETCDN --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 50.34| 15| 21| 240| 254| 4 --------------------------------------------------------------------------- 240- 254 (25.16/16.03) MIFSISSGVGNVNTS 263- 277 (25.18/16.05) LIFNRDEQLANIFNS --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 61.90| 18| 21| 91| 108| 5 --------------------------------------------------------------------------- 91- 108 (32.94/23.08) LDLLDVLIHCPSDPER.IQ 113- 131 (28.97/19.51) LRLLFINFHHLCNQLRpIQ --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) PIPKKYKLFGIDYDRD 2) RYYKKK 3) YAHEYT | 38 182 19 | 53 187 24 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab