<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04323
Description |
Putative transcription elongation factor S-II (inferred by orthology to a C. elegans protein) |
Sequence | MPSISEKDILDIKRRLQQMIDGQKEFVDAPELIAALEGMDITIDILKRTFIGITVNELRKKSGNEALNKRIKSLVKKWKSQMDTNVIKKPSNTPPQQDTPTAKKPTNNIVRPQPTPSTFTANVKIHKDEYRNKVIGMFISAFNIAELPEGTLDPEDLAVRIEEEHYKLNGGTNDKYKAAIRSKIFNLRDKKNPDLRANVLTGVITPERFATMTSEDMASDAMKKQREKYTQEAIREHQMSVAEGTPTDMFKCGKCRKYNCTYTQVQTRSADEPMTTFVFCRECGNRWKFC |
Length | 290 |
Position | Unknown |
Organism | Strongyloides venezuelensis (Threadworm) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Tylenchina> Panagrolaimomorpha> Strongyloidoidea> Strongyloididae>
Strongyloides.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.716 |
Instability index | 46.27 |
Isoelectric point | 9.22 |
Molecular weight | 33159.76 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | nucleic acid binding GO:0003676 IEA:InterPro
zinc ion binding GO:0008270 IEA:InterPro
|
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
transcription, DNA-templated GO:0006351 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP04323
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.36| 15| 18| 146| 160| 1
---------------------------------------------------------------------------
146- 160 (26.23/16.63) ELPEGTLDPEDLAVR
167- 181 (26.13/16.55) KLNGGTNDKYKAAIR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 77.95| 25| 26| 205| 229| 2
---------------------------------------------------------------------------
205- 229 (44.36/28.26) TPE..RFATMT.SEDMASDAMKKQR.EKY
230- 258 (33.59/19.84) TQEaiREHQMSvAEGTPTDMFKCGKcRKY
---------------------------------------------------------------------------
|