<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04312
Description |
Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MSHSAHQPTPNLLTYSFKNPSWPPNYINADNVLNYFCDPANIFYDKSSCNAVLTMQMANQQLDNNYIQNQLINMTGIQYVLVGIHHPLYIICKQVRNSPEEVTPHCYYYVMNGVVYQCPDMYSSIQCRLVSALHPMKKALTEVIDLCRFNVAKGYSWEFKNKVTKVNDEEENKDFEDPVQARSTNFQRTRTEQIMKLMMKKHKF |
Length | 204 |
Position | Head |
Organism | Strongyloides stercoralis (Threadworm) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Tylenchina> Panagrolaimomorpha> Strongyloidoidea> Strongyloididae>
Strongyloides.
|
Aromaticity | 0.11 |
Grand average of hydropathy | -0.498 |
Instability index | 36.33 |
Isoelectric point | 8.10 |
Molecular weight | 23852.09 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP04312
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.15| 19| 38| 13| 33| 1
---------------------------------------------------------------------------
13- 33 (33.14/28.47) LTYSFKNPSWPPNYInaDNVL
53- 71 (35.02/23.04) LTMQMANQQLDNNYI..QNQL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.09| 16| 45| 73| 88| 2
---------------------------------------------------------------------------
73- 88 (30.92/23.33) NM.TGIQYVLVGIHHPL
120- 136 (26.18/18.78) DMySSIQCRLVSALHPM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 50.98| 13| 40| 101| 113| 3
---------------------------------------------------------------------------
101- 113 (27.47/17.27) EVTPHCYYYVMNG
142- 154 (23.50/13.90) EVIDLCRFNVAKG
---------------------------------------------------------------------------
|