Description | Mediator of RNA polymerase II transcription subunit 9 |
Sequence | MEVSSIEHTDQKMVKNDPTSYSKTCLTEMHFALTDLIESFEVPNSSNINKKVKTVESRLELFKTSLDQIPDIDHNLLYQEKKIKDLRRCLELKKDLINRLYALPKKLEDIKPGKGINEISSKKSTTSK |
Length | 128 |
Position | Middle |
Organism | Strongyloides stercoralis (Threadworm) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida> Tylenchina> Panagrolaimomorpha> Strongyloidoidea> Strongyloididae> Strongyloides. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.706 |
Instability index | 48.85 |
Isoelectric point | 8.78 |
Molecular weight | 14767.88 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364145 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP04310 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 41.05| 13| 21| 75| 87| 1 --------------------------------------------------------------------------- 75- 87 (22.44/15.27) NLLYQ.EKKIKDLR 98- 111 (18.60/11.59) NRLYAlPKKLEDIK --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) IPDIDHNLLY 2) KKIKDLRRCLELKKDLINRLYALPKKLEDIKPGKGINEISSKK | 69 81 | 78 123 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab