<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04309
| Description |
Uncharacterized protein |
| Sequence | MAFTFWSSSHFKTWIIDPSCDYTIHRLHDVRLLGEENYEKVMIFFSNFIQTLGMDVLQSVGKIRMQVIATAIVYLRRFYSKRSFRDIDPFLLAPTCLYLACKSEEHGILHSSKLVLSANNALRKWPFLNKDIIINMNLIQEAEFYLLEIMDCSLIVFHPYRSLVPIIEDAKEFFKEQKDNCPFKDDKEWDSLVAETTKIINDSYRCDVPLKYAPHQIALGCMLLALINLKKETSFEDYYDAVDTDKEVIGDVVNELCGMYEIWKNFNEKEELKKIFEKIPRPNSSRQQYQSEIHESNSKNQFTF |
| Length | 304 |
| Position | Kinase |
| Organism | Strongyloides stercoralis (Threadworm) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Tylenchina> Panagrolaimomorpha> Strongyloidoidea> Strongyloididae>
Strongyloides.
|
| Aromaticity | 0.12 |
| Grand average of hydropathy | -0.244 |
| Instability index | 43.90 |
| Isoelectric point | 5.57 |
| Molecular weight | 35757.75 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP04309
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.51| 12| 43| 155| 166| 1
---------------------------------------------------------------------------
155- 166 (23.18/14.11) IVFHPYRSLVPI
199- 210 (23.33/14.25) IINDSYRCDVPL
---------------------------------------------------------------------------
|