<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04294
| Description |
Mediator of RNA polymerase II transcription subunit 10 |
| Sequence | MSSGERYMPSIARDCDQFKKDYERCFVTEFFPRFVDPNNSLVNHPNPCEQLHNVYKQCIETYFLKNKVQDIDFDDLQDDYWNDALDETGNKIPSPELRGENDDEENKKKSNLQSNNFRYVDPEDAKFEKLELDLGRFIEDVRQLGVTASDPGENANEIIRAKLLKIAAGLKNINEVSSQFMNHQIPIKIFDFVDDMKNPNAYSKAVFEETDAKNSEVNGKIEQYKKYKAKVLAKWSEEMPDAALQYMIMRKDSEGDKGPPFL |
| Length | 262 |
| Position | Middle |
| Organism | Strongyloides stercoralis (Threadworm) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Tylenchina> Panagrolaimomorpha> Strongyloidoidea> Strongyloididae>
Strongyloides.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.870 |
| Instability index | 43.99 |
| Isoelectric point | 4.81 |
| Molecular weight | 30394.64 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP04294
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.60| 15| 15| 105| 119| 1
---------------------------------------------------------------------------
105- 119 (25.38/15.14) ENKKKSNLQSNNFRY
123- 137 (24.22/14.15) EDAKFEKLELDLGRF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 35.74| 10| 15| 195| 204| 2
---------------------------------------------------------------------------
195- 204 (18.87/12.87) DMKNPNAYSK
211- 220 (16.87/10.76) DAKNSEVNGK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.13| 14| 22| 66| 79| 3
---------------------------------------------------------------------------
66- 79 (24.28/12.32) NKVQDIDFDDLQDD
90- 103 (24.85/12.75) NKIPSPELRGENDD
---------------------------------------------------------------------------
|