<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04292
| Description |
Uncharacterized protein |
| Sequence | MPSISEKDILDIKRRLQQMIDGQKEFVDAPELIAALESMDITIDILKRTLIGITVNELRRKSGNEALNKRIKSLVKKWKSQMETNVIKKSGNTPPPQQNVTTIKKPINNSSKPQPPPQTFTANVKIHKDDYRNKVIGMFISAFNVAELPEGTLDPEDLAVRIEEEHFKLHTSTNDKYKAAIRSKIFNLRDKKNPDLRANVLTGVISPEKFSTMTSEDMASDSMKKQREKYTQEAIREHQMSVAEGTPTDMFKCGKCRKYNCTYTQVQTRSADEPMTTFVFCRECGNRWKFC |
| Length | 291 |
| Position | Unknown |
| Organism | Strongyloides stercoralis (Threadworm) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Tylenchina> Panagrolaimomorpha> Strongyloidoidea> Strongyloididae>
Strongyloides.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.718 |
| Instability index | 46.87 |
| Isoelectric point | 9.29 |
| Molecular weight | 33323.96 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | nucleic acid binding GO:0003676 IEA:InterPro
zinc ion binding GO:0008270 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
transcription, DNA-templated GO:0006351 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP04292
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 73.13| 18| 18| 87| 104| 1
---------------------------------------------------------------------------
60- 76 (19.56/ 8.59) .RKSGNEALNKRIKSLVK
87- 104 (32.05/18.10) IKKSGNTPPPQQNVTTIK
107- 121 (21.51/10.08) INNSSKPQPPPQTFT...
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.83| 17| 18| 165| 181| 2
---------------------------------------------------------------------------
165- 181 (29.14/16.31) EHFKLHTSTNDKYKAAI
184- 200 (26.69/14.45) KIFNLRDKKNPDLRANV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 82.03| 24| 26| 229| 253| 3
---------------------------------------------------------------------------
229- 253 (38.23/21.76) KYTQEAIREHQMSVAEGTPTDMFkC
258- 281 (43.79/21.34) KYNCTYTQVQTRSADEPMTTFVF.C
---------------------------------------------------------------------------
|