<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04292

Description Uncharacterized protein
SequenceMPSISEKDILDIKRRLQQMIDGQKEFVDAPELIAALESMDITIDILKRTLIGITVNELRRKSGNEALNKRIKSLVKKWKSQMETNVIKKSGNTPPPQQNVTTIKKPINNSSKPQPPPQTFTANVKIHKDDYRNKVIGMFISAFNVAELPEGTLDPEDLAVRIEEEHFKLHTSTNDKYKAAIRSKIFNLRDKKNPDLRANVLTGVISPEKFSTMTSEDMASDSMKKQREKYTQEAIREHQMSVAEGTPTDMFKCGKCRKYNCTYTQVQTRSADEPMTTFVFCRECGNRWKFC
Length291
PositionUnknown
OrganismStrongyloides stercoralis (Threadworm)
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida> Tylenchina> Panagrolaimomorpha> Strongyloidoidea> Strongyloididae> Strongyloides.
Aromaticity0.06
Grand average of hydropathy-0.718
Instability index46.87
Isoelectric point9.29
Molecular weight33323.96
Publications









Function






Annotated function


GO - Cellular Component
nucleus	GO:0005634	IEA:UniProtKB-SubCell

GO - Biological Function
nucleic acid binding	GO:0003676	IEA:InterPro
zinc ion binding	GO:0008270	IEA:InterPro

GO - Biological Process
regulation of transcription, DNA-templated	GO:0006355	IEA:InterPro
transcription, DNA-templated	GO:0006351	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP04292
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      73.13|      18|      18|      87|     104|       1
---------------------------------------------------------------------------
   60-   76 (19.56/ 8.59)	.RKSGNEALNKRIKSLVK
   87-  104 (32.05/18.10)	IKKSGNTPPPQQNVTTIK
  107-  121 (21.51/10.08)	INNSSKPQPPPQTFT...
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      55.83|      17|      18|     165|     181|       2
---------------------------------------------------------------------------
  165-  181 (29.14/16.31)	EHFKLHTSTNDKYKAAI
  184-  200 (26.69/14.45)	KIFNLRDKKNPDLRANV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      82.03|      24|      26|     229|     253|       3
---------------------------------------------------------------------------
  229-  253 (38.23/21.76)	KYTQEAIREHQMSVAEGTPTDMFkC
  258-  281 (43.79/21.34)	KYNCTYTQVQTRSADEPMTTFVF.C
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP04292 with Med26 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) TNVIKKSGNTPPPQQNVTTIKKPINNSSKPQPPPQTFTANVK
84
125










Molecular Recognition Features






MoRF SequenceStartStop




NANANA