<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04289
| Description |
Uncharacterized protein |
| Sequence | MELVTIVHEASLQWRQEYERVVDAILCYAYSAGVLSINMCVEGLALTADFTLRTIMDPQKWTFIDENIPLMDYKGVRSLFKCLIYQQFNSIPAQLSPEQRRQLLPAERILLKILDPDLNVIPPIFTLTELSRGILKRAYMFPGLLRQVTHGRTQWDEILSVLISETMAEVIKAFLFYYELCFLISARYTLVHLSQ |
| Length | 195 |
| Position | Tail |
| Organism | Angiostrongylus cantonensis (Rat lungworm) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Strongylida>
Metastrongyloidea> Angiostrongylidae> Angiostrongylus.
|
| Aromaticity | 0.11 |
| Grand average of hydropathy | 0.229 |
| Instability index | 43.62 |
| Isoelectric point | 5.64 |
| Molecular weight | 22623.30 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP04289
No repeats found
|