<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04270
| Description |
Uncharacterized protein |
| Sequence | MAGNFWQSSHYDQWIFDKHELLRMRSEDLKIYTEEEYQKLMIFWANLIQTLAVEGIQQGQPKTRMQVIATAIVYFKRFYARRSYKDVDPLLIACASVFLSSKVEEHGLMSMSNLIKTIPNCLKKWPNLTYDASSKNSGLYDAEFILVEMLDCCLVVYHPYRPLSTMLQVIMIFKTSWTVIVINSIPRIRDLAVEQCWKLSSLANDSLRSDCCLLYPPHIIAISCIIVGAELMNREKDIKMWLPELSADFEKVYDCVNTIFTMYKTWKTFDEKEHVKPLFDKLPKINPGPSF |
| Length | 291 |
| Position | Kinase |
| Organism | Angiostrongylus cantonensis (Rat lungworm) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Strongylida>
Metastrongyloidea> Angiostrongylidae> Angiostrongylus.
|
| Aromaticity | 0.12 |
| Grand average of hydropathy | -0.044 |
| Instability index | 43.25 |
| Isoelectric point | 6.98 |
| Molecular weight | 33942.36 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP04270
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 40.28| 9| 56| 151| 160| 1
---------------------------------------------------------------------------
151- 160 (18.18/14.37) DCCLvVYHPY
210- 218 (22.10/12.86) DCCL.LYPPH
---------------------------------------------------------------------------
|