<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04265
| Description |
Uncharacterized protein |
| Sequence | MAHDGFVRFGRWFTRPLREPPFGRQRLLPRYIMATNVQFFVHGGNTVCMTVNAQRQPPLLRLCKRYIVDFAPLFLFSDHVESGRRVQVVVGPWSLRAVLLPADTEIGRNQASAEKQWEEWKEFVASLAENLEESDEESRVSLLNVSGSDYCAK |
| Length | 153 |
| Position | Middle |
| Organism | Angiostrongylus cantonensis (Rat lungworm) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Strongylida>
Metastrongyloidea> Angiostrongylidae> Angiostrongylus.
|
| Aromaticity | 0.11 |
| Grand average of hydropathy | -0.286 |
| Instability index | 47.52 |
| Isoelectric point | 7.76 |
| Molecular weight | 17584.88 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP04265
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.50| 13| 34| 18| 32| 1
---------------------------------------------------------------------------
18- 32 (22.46/18.84) REPPFgrQRLLPRYI
55- 67 (27.04/15.46) RQPPL..LRLCKRYI
---------------------------------------------------------------------------
|