Description | Mediator of RNA polymerase II transcription subunit 16 (Fragment) |
Sequence | XLALAFHDGSVHIVHRLSLQTMAVFYSSAAPRPVDEPAMKRPRTAGPAVHLKAMQLSWTSLALVGIDSHGKLSVLRLSPSMGHPLEVGLALRHLLFLLEYCMVTGYDWWDILLHVQPSMVQSLVEKLHEEYTRQTAALQQVLSTRILAMKASLCKLSPCTVTRVCDYHTKLFLIAISSTLKSLLRPHFLNTPDKSPGDRLTEICTKITDVDIDKVMINLKTEEFVLDMNTLQALQQLLQWVGDFVLYLLASLPNQGSLLRPGHSFLRDGTSLGMLRELMVVIRIWGLLKPSCLPVYTATSDTQDSMSLLFRLLTKLWICCRDEGPASEPDEALVDECCLLPSQLLIPSLDWLPASDGLVSRLQPKQPLRLQFGRAPTLPGSAATLQLDGLARAPGQPKIDHLRRLHLGACPTEECKACTRCGCVTMLKSPNRTTAVKQWEQRWIKNCLCGGLWWRVPLSYP |
Length | 461 |
Position | Tail |
Organism | Homo sapiens (Human) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini> Hominidae> Homo. |
Aromaticity | 0.06 |
Grand average of hydropathy | 0.079 |
Instability index | 54.15 |
Isoelectric point | 8.62 |
Molecular weight | 51350.77 |
Publications | PubMed=15057824 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364149 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | |
GO - Biological Process |
Binary Interactions |
Repeats | >MDP04262 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 105.58| 25| 74| 164| 189| 1 --------------------------------------------------------------------------- 164- 189 (39.77/33.61) VCDYhTKLFLIAISSTLKSLLRP.H.FL 203- 225 (33.95/22.45) IC...TKITDVDIDKVMINLKTE.E.FV 241- 266 (31.86/20.61) VGDF..VLYLLASLPNQGSLLRPgHsFL --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 78.00| 22| 32| 363| 384| 2 --------------------------------------------------------------------------- 363- 384 (41.84/24.24) QPK.QPL.RLQFGRAPTLPGSAAT 396- 419 (36.16/20.00) QPKiDHLrRLHLGACPTEECKACT --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 121.85| 38| 39| 11| 48| 3 --------------------------------------------------------------------------- 11- 48 (68.24/48.29) VHI.VHRLSLQTMA.VFYSSAAPRPVDE..PAMKRPRTAGPA 49- 90 (53.61/36.32) VHLkAMQLSWTSLAlVGIDSHGKLSVLRlsPSMGHPLEVGLA --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 57.61| 16| 33| 312| 327| 4 --------------------------------------------------------------------------- 312- 327 (32.52/17.36) LL.TKLWICCRDEGPAS 339- 355 (25.09/11.87) LLpSQLLIPSLDWLPAS --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 50.67| 12| 343| 101| 113| 6 --------------------------------------------------------------------------- 101- 113 (23.19/18.40) CMVTGYdWWDILL 447- 458 (27.48/16.57) CLCGGL.WWRVPL --------------------------------------------------------------------------- |
Disease | papillary thyroid cancer PMID:32532820 |
MoRF Sequence | Start | Stop |
1) EEFVL 2) SLLRPHFLNTPDKSPGDRLTEICTK | 41 1 | 45 25 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab