<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04262

Description Mediator of RNA polymerase II transcription subunit 16 (Fragment)
SequenceXLALAFHDGSVHIVHRLSLQTMAVFYSSAAPRPVDEPAMKRPRTAGPAVHLKAMQLSWTSLALVGIDSHGKLSVLRLSPSMGHPLEVGLALRHLLFLLEYCMVTGYDWWDILLHVQPSMVQSLVEKLHEEYTRQTAALQQVLSTRILAMKASLCKLSPCTVTRVCDYHTKLFLIAISSTLKSLLRPHFLNTPDKSPGDRLTEICTKITDVDIDKVMINLKTEEFVLDMNTLQALQQLLQWVGDFVLYLLASLPNQGSLLRPGHSFLRDGTSLGMLRELMVVIRIWGLLKPSCLPVYTATSDTQDSMSLLFRLLTKLWICCRDEGPASEPDEALVDECCLLPSQLLIPSLDWLPASDGLVSRLQPKQPLRLQFGRAPTLPGSAATLQLDGLARAPGQPKIDHLRRLHLGACPTEECKACTRCGCVTMLKSPNRTTAVKQWEQRWIKNCLCGGLWWRVPLSYP
Length461
PositionTail
OrganismHomo sapiens (Human)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini> Hominidae> Homo.
Aromaticity0.06
Grand average of hydropathy0.079
Instability index54.15
Isoelectric point8.62
Molecular weight51350.77
Publications
PubMed=15057824

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP04262
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     105.58|      25|      74|     164|     189|       1
---------------------------------------------------------------------------
  164-  189 (39.77/33.61)	VCDYhTKLFLIAISSTLKSLLRP.H.FL
  203-  225 (33.95/22.45)	IC...TKITDVDIDKVMINLKTE.E.FV
  241-  266 (31.86/20.61)	VGDF..VLYLLASLPNQGSLLRPgHsFL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      78.00|      22|      32|     363|     384|       2
---------------------------------------------------------------------------
  363-  384 (41.84/24.24)	QPK.QPL.RLQFGRAPTLPGSAAT
  396-  419 (36.16/20.00)	QPKiDHLrRLHLGACPTEECKACT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     121.85|      38|      39|      11|      48|       3
---------------------------------------------------------------------------
   11-   48 (68.24/48.29)	VHI.VHRLSLQTMA.VFYSSAAPRPVDE..PAMKRPRTAGPA
   49-   90 (53.61/36.32)	VHLkAMQLSWTSLAlVGIDSHGKLSVLRlsPSMGHPLEVGLA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      57.61|      16|      33|     312|     327|       4
---------------------------------------------------------------------------
  312-  327 (32.52/17.36)	LL.TKLWICCRDEGPAS
  339-  355 (25.09/11.87)	LLpSQLLIPSLDWLPAS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      50.67|      12|     343|     101|     113|       6
---------------------------------------------------------------------------
  101-  113 (23.19/18.40)	CMVTGYdWWDILL
  447-  458 (27.48/16.57)	CLCGGL.WWRVPL
---------------------------------------------------------------------------











Associated diseases
Disease
papillary thyroid cancer	PMID:32532820



























Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP04262 with Med16 domain of Kingdom Metazoa
Unable to open file!