<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04257

Description Mediator of RNA polymerase II transcription subunit 16 (Fragment)
SequenceXLALAFHDGSVHIVHRLSLQTMAVFYSSAAPRPVDEPAMKRPRTAGPAVHLKAMQLSWTSLALVGIDSHGKLSVLRLSPSMGHPLEVGLALRHLLFLLEYCMVTGYDWWDILLHVQPSMVQSLVEKLHEEYTRQTAALQQVLSTRILAMKASLCKLSPCTVTRVCDYHTKLFLIAISSTLKSLLRPHFLNTPDKSPGDRLTEICTKITDVDIDKVMINLKTEEFVLDMNTLQALQQLLQWVGDFVLYLLASLPNQGSLLRPGHSFLRDGTSLGMLRELMVVIRIWGLLKPSCLPVYTATSDTQDSMSLLFRLLTKLWICFPSTGPCSVWVLLGWQPLPGRDEGPASEPDEALVDECCLLPSQLLIPSLDWLPASDGLVSRLQPKQPLRLQFGRAPTLPGSAATLQLDGLARAPGQPKIDHLRRLHLGACPTEECKACTRCGCVTMLKSPNRTTAVKQWEQRWIKNCLCGGLWWRVPLSYP
Length480
PositionTail
OrganismHomo sapiens (Human)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini> Hominidae> Homo.
Aromaticity0.07
Grand average of hydropathy0.091
Instability index53.75
Isoelectric point8.62
Molecular weight53371.10
Publications
PubMed=15057824

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP04257
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      71.96|      24|      74|     164|     189|       1
---------------------------------------------------------------------------
  164-  189 (38.64/27.50)	VCDYhtKLFLIAISSTLKSLLRP.H.FL
  241-  266 (33.32/17.22)	VGDF..VLYLLASLPNQGSLLRPgHsFL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      78.00|      22|      32|     382|     403|       2
---------------------------------------------------------------------------
  382-  403 (41.84/21.95)	QPK.QPL.RLQFGRAPTLPGSAAT
  415-  438 (36.16/18.11)	QPKiDHLrRLHLGACPTEECKACT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      93.20|      26|     217|      91|     117|       3
---------------------------------------------------------------------------
   91-  117 (48.77/26.19)	LRHLLFLLEYCM.VTG.YDWWdILLHVQP
  309-  336 (44.43/20.08)	LFRLLTKLWICFpSTGpCSVW.VLLGWQP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      45.26|      13|      25|     338|     353|       4
---------------------------------------------------------------------------
  338-  353 (19.38/20.30)	PGRDEGPASepdEALV
  366-  378 (25.88/15.76)	PSLDWLPAS...DGLV
---------------------------------------------------------------------------


Associated diseases

Disease
papillary thyroid cancer	PMID:32532820


Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP04257 with Med16 domain of Kingdom Metazoa

Unable to open file!