<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04256
| Description |
Mediator of RNA polymerase II transcription subunit 16 (Fragment) |
| Sequence | XLALAFHDGSVHIVHRLSLQTMAVFYSSAAPRPVDEPAMKRPRTAGPAVHLKAMQLSWTSLALVGIDSHGKLSVLRLSPSMGHPLEVGLALRHLLFLLEYCMVTGYDWWDILLHVQPSMVQSLVEKLHEEYTRQTAALQQVLSTRILAMKASLCKLSPCTVTRVCDYHTKLFLIAISSTLKSLLRPHFLNTPDKSPGDRLTEICTKITDVDIDKVMINLKTEEFVLDMNTLQALQQLLQWVGDFVLYLLASLPNQGSLLRPGHSFLRDGTSLGMLRELMVVIRIWGLLKPSCLPVYTATSDTQDSMSLLFRLLTKLWICCRDEGPASEPDEALVDECCLLPSQLLIPSLDWLPASDGLVSRLQPKQPLRLQFGRAPTLPGSAATLQLDGLARAPGQPKIDHLRRLHLGACPTEECKACTRCGCVTMLKSPNRTTAVKQWEQRWIKNCLAVEGRGPDACVTSRASEEAPAFVQLGPQSTHHSPRTPRSLDHLHPKDRP |
| Length | 497 |
| Position | Tail |
| Organism | Homo sapiens (Human) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini> Hominidae>
Homo.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.026 |
| Instability index | 54.95 |
| Isoelectric point | 8.52 |
| Molecular weight | 55113.74 |
| Publications | PubMed=15057824
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364149
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP04256
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 105.58| 25| 74| 164| 189| 1
---------------------------------------------------------------------------
164- 189 (39.77/31.68) VCDYhTKLFLIAISSTLKSLLRP.H.FL
203- 225 (33.95/21.16) IC...TKITDVDIDKVMINLKTE.E.FV
241- 266 (31.86/19.43) VGDF..VLYLLASLPNQGSLLRPgHsFL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 102.00| 22| 32| 363| 384| 2
---------------------------------------------------------------------------
341- 361 (29.03/14.88) .PS.QLL.IPSLDWLPASDGLVSR
363- 384 (39.65/23.20) QPK.QPL.RLQFGRAPTLPGSAAT
396- 419 (33.32/18.24) QPKiDHLrRLHLGACPTEECKACT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 121.85| 38| 39| 11| 48| 3
---------------------------------------------------------------------------
11- 48 (68.24/42.54) VHI.VHRLSLQTMA.VFYSSAAPRPVDE..PAMKRPRTAGPA
49- 90 (53.61/31.90) VHLkAMQLSWTSLAlVGIDSHGKLSVLRlsPSMGHPLEVGLA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 84.96| 25| 38| 267| 294| 4
---------------------------------------------------------------------------
267- 294 (42.06/27.85) RDGTSL..GMLRELMVVIRIWGllkPSCLP
303- 329 (42.90/21.94) QDSMSLlfRLLTKLWICCRDEG...PASEP
---------------------------------------------------------------------------
|
Associated diseases