Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MDSIGSGVASSGSLRTKISLKGRYSQLSLVCPFHLMKPELPQQSVLLGSNDLLAEYDMGSSYQRFCGSKRLREDLGSFLPHLVGSFNFENALEFSSLRMLVEKPPITGKEITSLSAGAMAGFRLTPGAVPEPYRYFDNKVDDLSSDTMNYDENGEETKHKRKYKWSLDDLDDADLDRKYRKHRSEDKDRKKEKKKKKDKKRKRDSKEEDQNNKVRKV |
Length | 217 |
Position | Head |
Organism | Brugia malayi (Filarial nematode worm) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida> Spirurina> Spiruromorpha> Filarioidea> Onchocercidae> Brugia. |
Aromaticity | 0.08 |
Grand average of hydropathy | -0.997 |
Instability index | 40.28 |
Isoelectric point | 9.29 |
Molecular weight | 24865.86 |
Publications | PubMed=17885136 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP04251 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 69.46| 15| 15| 178| 192| 1 --------------------------------------------------------------------------- 162- 176 (23.32/10.70) KYKWSLDDLDDADLD 178- 192 (24.09/11.26) KYRKHRSEDKDRKKE 194- 208 (22.05/ 9.76) KKKKDKKRKRDSKEE --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 46.94| 15| 16| 57| 71| 2 --------------------------------------------------------------------------- 50- 68 (24.36/14.53) NDLlaeyDMGSSYQRFCGS 69- 85 (22.58/13.03) KRL..reDLGSFLPHLVGS --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 61.07| 19| 26| 101| 119| 3 --------------------------------------------------------------------------- 101- 119 (31.56/21.89) VEKP.PITGKEITSLSAGAM 129- 148 (29.50/20.03) VPEPyRYFDNKVDDLSSDTM --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) DLDRKYRKHRSEDKDRKKEKKKKKDKKRKRDSKEEDQNN 2) PYRYFDN | 174 132 | 212 138 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab