<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04246

Description Mediator of RNA polymerase II transcription subunit 5
SequenceMTSFTPDQQLQKLINAAFHLRLSPQKFAKLFSQLQERVHLEANLAGDAFFRTLSPETKSIDALFIQYIVTLAFDFKSPLCVPKLLYYIRVAQRKALKNDPSAVVAYEVLTFCEPLIFVALTKSLHLWPQDPSSVTPETRRSLLILLIGYMADCSNAESHPSHQKTRAIAAFLLALARTKVVLQILPAKNTNHKEFEAFDMAISKFSKLLETMDPVLAHDLRTAYAAIFDAIKHPNAIAKTFDSFKPTRVFKLIWLEALLITNRATQHDVFRAEAQVFLLHENPVKLIPSLITAAFDGLSVALLRNDSAQTIALWKAFITKRLPLIVKDLLASSFININPTLIESMICNPITTLSNDTLTLMQRAAGNSSLVDEMFPSEGAANTQYGLRYDFLRVLVSLSVLTEHAFLSVVSDPNFSPPTVPRVDLAALNDNGLIVNFATNESFLVGELVASALNENSEYTPFENSAIVRLVSTVRDLEGIYQERLANEFLQLLSSWIEGSNTHNISRFCQALALSVPTMDVLLLHISPKDLFGPLAKLIDDWQHDEDEINFQEVYTDFGCILLTLVLAYERFGLSLSTHLGCHEREGSFFQSLVGQRGINENLDELSPQRRDLLGGWISALFDAGGISDDLMRVSSVKDLYTLVPAIFRQAVVAFSAKIIDFEVLRGGLEYFLQPFLLPSLLLAFRWVGDGLWRQADVMTLVQIVQFLLMSDISPEAQRIHQIVLSITASELFQMLTHVAATASTTNGGSNGDQDQLFVEPRLLSILEQFYVAAPRDPLTELQSSVADALAHHVTALTQWASAPADAGPPGYHFGLVSRAVAELGATRVLLALLDCLDAAGGAGMAEGAAAGTPQFETTLEVVTALVTQSVSDNSANLNLRLDGNLVRTVVDCTEEEMRQLRVAATIGTKQESVAVPGATPGTAIATPAAAATPAPSLYGFKRLQANANAYTAGRGRP
Length958
PositionTail
OrganismGeotrichum candidum (Oospora lactis) (Dipodascus geotrichum)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Dipodascaceae> Geotrichum.
Aromaticity0.08
Grand average of hydropathy0.177
Instability index36.24
Isoelectric point5.34
Molecular weight105098.41
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP04246
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      58.05|      17|      55|     282|     299|       1
---------------------------------------------------------------------------
  282-  299 (25.88/19.33)	NPvKLIPSLITAAFDGLS
  338-  354 (32.17/19.64)	NP.TLIESMICNPITTLS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      44.50|      14|      28|      90|     103|       2
---------------------------------------------------------------------------
   90-  103 (24.59/15.51)	VAQRKALK...NDPSAV
  118-  134 (19.90/11.20)	VALTKSLHlwpQDPSSV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      83.59|      27|     165|      44|      86|       3
---------------------------------------------------------------------------
   13-   41 (42.16/18.94)	LINAAFHLRLSP..QKFAKLFsqLQERVHLE
   44-   72 (41.43/57.20)	LAGDAFFRTLSPetKSIDALF..IQYIVTLA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     164.07|      39|     165|     370|     408|       4
---------------------------------------------------------------------------
  370-  408 (66.82/44.43)	LVDEMFPSEGAANTQYGLRY.DFLRVLVSLSVLTEHAFLS
  498-  524 (37.86/21.94)	........EG.SNTHNISR...FCQAL.ALSVPTMDVLLL
  538-  575 (59.39/38.66)	LIDDWQHDEDEINFQE..VYtDFGCILLTLVLAYERFGLS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      42.55|      13|      26|     238|     250|       5
---------------------------------------------------------------------------
  238-  250 (23.62/13.79)	AKTFDSFK.PTRVF
  264-  277 (18.93/ 9.73)	ATQHDVFRaEAQVF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      39.49|      11|      15|     779|     789|       6
---------------------------------------------------------------------------
  779-  789 (18.36/10.00)	LTELQSSVADA
  797-  807 (21.13/12.60)	LTQWASAPADA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      62.64|      20|      24|     427|     449|       7
---------------------------------------------------------------------------
  427-  449 (28.40/27.26)	ALNDNGLIVNFatnESFLVGELV
  452-  471 (34.23/23.22)	ALNENSEYTPF...ENSAIVRLV
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP04246 with Med5 domain of Kingdom Fungi
Unable to open file!