<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04246
| Description |
Mediator of RNA polymerase II transcription subunit 5 |
| Sequence | MTSFTPDQQLQKLINAAFHLRLSPQKFAKLFSQLQERVHLEANLAGDAFFRTLSPETKSIDALFIQYIVTLAFDFKSPLCVPKLLYYIRVAQRKALKNDPSAVVAYEVLTFCEPLIFVALTKSLHLWPQDPSSVTPETRRSLLILLIGYMADCSNAESHPSHQKTRAIAAFLLALARTKVVLQILPAKNTNHKEFEAFDMAISKFSKLLETMDPVLAHDLRTAYAAIFDAIKHPNAIAKTFDSFKPTRVFKLIWLEALLITNRATQHDVFRAEAQVFLLHENPVKLIPSLITAAFDGLSVALLRNDSAQTIALWKAFITKRLPLIVKDLLASSFININPTLIESMICNPITTLSNDTLTLMQRAAGNSSLVDEMFPSEGAANTQYGLRYDFLRVLVSLSVLTEHAFLSVVSDPNFSPPTVPRVDLAALNDNGLIVNFATNESFLVGELVASALNENSEYTPFENSAIVRLVSTVRDLEGIYQERLANEFLQLLSSWIEGSNTHNISRFCQALALSVPTMDVLLLHISPKDLFGPLAKLIDDWQHDEDEINFQEVYTDFGCILLTLVLAYERFGLSLSTHLGCHEREGSFFQSLVGQRGINENLDELSPQRRDLLGGWISALFDAGGISDDLMRVSSVKDLYTLVPAIFRQAVVAFSAKIIDFEVLRGGLEYFLQPFLLPSLLLAFRWVGDGLWRQADVMTLVQIVQFLLMSDISPEAQRIHQIVLSITASELFQMLTHVAATASTTNGGSNGDQDQLFVEPRLLSILEQFYVAAPRDPLTELQSSVADALAHHVTALTQWASAPADAGPPGYHFGLVSRAVAELGATRVLLALLDCLDAAGGAGMAEGAAAGTPQFETTLEVVTALVTQSVSDNSANLNLRLDGNLVRTVVDCTEEEMRQLRVAATIGTKQESVAVPGATPGTAIATPAAAATPAPSLYGFKRLQANANAYTAGRGRP |
| Length | 958 |
| Position | Tail |
| Organism | Geotrichum candidum (Oospora lactis) (Dipodascus geotrichum) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Dipodascaceae> Geotrichum.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | 0.177 |
| Instability index | 36.24 |
| Isoelectric point | 5.34 |
| Molecular weight | 105098.41 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364142
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP04246
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 58.05| 17| 55| 282| 299| 1
---------------------------------------------------------------------------
282- 299 (25.88/19.33) NPvKLIPSLITAAFDGLS
338- 354 (32.17/19.64) NP.TLIESMICNPITTLS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 44.50| 14| 28| 90| 103| 2
---------------------------------------------------------------------------
90- 103 (24.59/15.51) VAQRKALK...NDPSAV
118- 134 (19.90/11.20) VALTKSLHlwpQDPSSV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 83.59| 27| 165| 44| 86| 3
---------------------------------------------------------------------------
13- 41 (42.16/18.94) LINAAFHLRLSP..QKFAKLFsqLQERVHLE
44- 72 (41.43/57.20) LAGDAFFRTLSPetKSIDALF..IQYIVTLA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 164.07| 39| 165| 370| 408| 4
---------------------------------------------------------------------------
370- 408 (66.82/44.43) LVDEMFPSEGAANTQYGLRY.DFLRVLVSLSVLTEHAFLS
498- 524 (37.86/21.94) ........EG.SNTHNISR...FCQAL.ALSVPTMDVLLL
538- 575 (59.39/38.66) LIDDWQHDEDEINFQE..VYtDFGCILLTLVLAYERFGLS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 42.55| 13| 26| 238| 250| 5
---------------------------------------------------------------------------
238- 250 (23.62/13.79) AKTFDSFK.PTRVF
264- 277 (18.93/ 9.73) ATQHDVFRaEAQVF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 39.49| 11| 15| 779| 789| 6
---------------------------------------------------------------------------
779- 789 (18.36/10.00) LTELQSSVADA
797- 807 (21.13/12.60) LTQWASAPADA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 62.64| 20| 24| 427| 449| 7
---------------------------------------------------------------------------
427- 449 (28.40/27.26) ALNDNGLIVNFatnESFLVGELV
452- 471 (34.23/23.22) ALNENSEYTPF...ENSAIVRLV
---------------------------------------------------------------------------
|