<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04220
| Description |
Mediator of rna polymerase ii transcription subunit 27-like protein |
| Sequence | MEQLQAALTAIKVLRSNVGQVFDSLGNGLRAEHGDENKESKYLLELQELLTTVNLNLRQVDSMLSTVERQFSDMTVSVSRPFASNAVLHVTLGHVLKALIAFKGLMIERVVIKGYGETMDLWTESRHKVFRKVTENAHAAMLHFHSLALPELAVRSFMVMVR |
| Length | 162 |
| Position | Tail |
| Organism | Lasius niger (Black garden ant) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Hymenoptera> Apocrita> Aculeata> Formicoidea>
Formicidae> Formicinae> Lasius> Lasius.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | 0.060 |
| Instability index | 35.55 |
| Isoelectric point | 8.11 |
| Molecular weight | 18218.99 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP04220
No repeats found
No repeats found
|