<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04218
| Description |
Mediator of RNA polymerase II transcription subunit 20 |
| Sequence | MPVTGLFFIPANPNSSTALGTVANQLRAAYNAVPTGRWALEHKLLRDTPSCLPPSAYAPLPQLQPRFMHFLSLSHFQSHGFVYISDRPSPDPWAPSQPHHSQAGIHAHPTQQQIPPQPSSSNRLVKEEDAPQVSRSSSSSSWTMMTLDPASFNSFLAITLRACEPLWCHRHTMLVTGGTIFEVGDFRIRIGDLRQTQPVQRVRGCIVEIEYRGPGQTVTPKDSDWYLPVSEPATSAALGVEDGFLGIAGGAGDGEEELLTEEDWVVGEKLIREFWGRFAVPGAKEAIRVPGLLTETNKARQRGTKRLTTMDAGVTNTGIAGADLARQYMELLRFNR |
| Length | 336 |
| Position | Head |
| Organism | Coccidioides immitis RMSCC 2394 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Onygenales> Onygenales incertae sedis> Coccidioides.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.331 |
| Instability index | 54.75 |
| Isoelectric point | 6.56 |
| Molecular weight | 36949.38 |
| Publications | PubMed=20516208
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP04218
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 63.55| 17| 18| 84| 101| 1
---------------------------------------------------------------------------
84- 101 (30.49/18.29) ISDRPSpDPWAPSQPHHS
105- 121 (33.06/15.37) IHAHPT.QQQIPPQPSSS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.41| 13| 37| 213| 225| 4
---------------------------------------------------------------------------
213- 225 (25.75/17.27) GPGQTVTPKDSDW
252- 264 (23.65/15.26) GDGEEELLTEEDW
---------------------------------------------------------------------------
|