<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04207

Description Uncharacterized protein
SequenceMTKQNELVATSLSSEPPQGARSLSVHVQNHRALWDQKPPNYPLQIDHHGALLSDKIFEFWLMADILTQLQTCLDQLATQFYATVAYLTTYHDHSPAIPPPNVPSAVPQLKKIPKNPPPAAPTSGTATNTPGAAGGPSGDTKDAAAGPSNAPQMQQQHQEQPPDAPPRPDSPNTFLMRQRELARDLIIKEQQIEYLISVLPGIKSSEAEQQERIKQLAEELRVVEEERSARRRELRRLGEKVDGLLGAVSRGTGISNSG
Length258
PositionMiddle
OrganismCoccidioides immitis RMSCC 2394
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Onygenales> Onygenales incertae sedis> Coccidioides.
Aromaticity0.04
Grand average of hydropathy-0.638
Instability index60.42
Isoelectric point6.17
Molecular weight28260.46
Publications
PubMed=20516208

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
ECO:0000256	ARBA:ARBA00003669
ECO:0000256	RuleBase:RU366036
GO - Cellular Component
mediator complex	GO:0016592	IEA:UniProtKB-UniRule
GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP04207
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      50.96|      15|      19|      15|      33|       1
---------------------------------------------------------------------------
   15-   33 (21.50/19.79)	EPPqgarSLSVHVQNHRAL
   37-   51 (29.46/15.93)	KPP....NYPLQIDHHGAL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      51.68|      13|      65|      91|     103|       2
---------------------------------------------------------------------------
   91-  103 (27.26/ 9.59)	HDHSPAIPPPNVP
  109-  121 (24.42/ 8.01)	LKKIPKNPPPAAP
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP04207 with Med21 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) DHSPAIPPPNVPSAVPQLKKIPKNPPPAAPTSGTATNTPGAAGGPSGDTKDAAAGPSNAPQMQQQHQEQPPDAPPRPDSPNTFLMRQRELA
2) KSSEAEQQERIKQLAEELRVVEEERSARRRELRR
92
203
182
236










Molecular Recognition Features






MoRF SequenceStartStop




NANANA