<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04203

Description Mediator of RNA polymerase II transcription subunit 6
SequenceMEPSPDVPLEEITWHSPQHVQMMGGFLHSNNILFYFAESPFFDPTSNNASLALQAMHNENLRPFIETREAFEGRLKTMQGLKFIVAHDPLLEAAAANAAAVARGEQPKEASNVWVIRKQMRRRSAGMGGQDDVQVLATYFVVGDSVFMAPSVWSVVGRRMLSTVTSLTKVLSTASALLTFSPSYGHSYLPHVPRSLEPTQLGQQSAQQSKETTPMPDMSGDKTTSRSALADASTTTLDASSLQDARDFAETLNLLARYGNEYIDETPLVGEPGSFIFTKASASAPEQLSVAGAGAQAARQNIRSGATTPVPFGAGRPASVQPDSTKGKAADRPPAATKDKGKKRKSKIG
Length349
PositionHead
OrganismCoccidioides immitis RMSCC 2394
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Onygenales> Onygenales incertae sedis> Coccidioides.
Aromaticity0.07
Grand average of hydropathy-0.358
Instability index56.36
Isoelectric point7.93
Molecular weight37495.80
Publications
PubMed=20516208

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP04203
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     133.33|      32|      71|     178|     209|       1
---------------------------------------------------------------------------
  178-  209 (55.06/32.95)	LTFSPSYGHSYLPHVP.RSLEPTQLGQQSAQQS
  218-  246 (29.06/14.29)	MSGDKTTSRSALADAStTTLDASSL..QDAR..
  252-  283 (49.21/28.75)	LNLLARYGNEYIDETP.LVGEPGSFIFTKASAS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      79.89|      22|     103|      23|      44|       2
---------------------------------------------------------------------------
   23-   44 (43.38/34.56)	MGGFLHSNNILFYF..AESPFFDP
  127-  150 (36.51/27.90)	MGGQDDVQVLATYFvvGDSVFMAP
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP04203 with Med6 domain of Kingdom Fungi
Unable to open file!