<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04197

Description Kinase-like protein
SequenceMDSSRSQGAMVDPMHAYRAKRDRERRTVLKAYKILGFISSGTYGRVYKAVLLAPPKLNGKSALPSSARAALGVAKSPSPFISDDPLNNPELCMRPGDLPAKEGDVFAIKKFKPDKEGDQQTYAGISQSGAREIMLNRELHHRNLVALREVILEDKAIYMVFEYAEHDFLQIIHHHSQTLRTAIPPTTLRRLLHQLLAGLHFLHSQFVMHRDLKPANILVTNSGVVKIGDLGLARLWHKPLAQGGLYGGDKVVVTIWYRAPELILGSKHYTAAVDLWAVGCIYAELLSLRPIFKGEEAKLDSKKTLPFQRDQMAKICDVLDAVKPEHWPGVVNMPEWKTYLAQGPYPTASPLPTWYANRSGSSHGFDLLTKLFEWDPAQRITAREALSHPWFQEEGGCNFESVFEGANVNYPHRRVTHEDNGDPKMGSLPPSLAGGRLPSSSNFRPATGSLPPAKRTRLAR
Length460
PositionKinase
OrganismCutaneotrichosporon oleaginosum
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Tremellomycetes> Trichosporonales> Trichosporonaceae> Cutaneotrichosporon.
Aromaticity0.08
Grand average of hydropathy-0.361
Instability index48.72
Isoelectric point9.42
Molecular weight51285.30
Publications









Function






Annotated function


GO - Cellular Component
euchromatin	GO:0000791	IEA:EnsemblFungi
mediator complex	GO:0016592	IEA:EnsemblFungi

GO - Biological Function
ATP binding	GO:0005524	IEA:InterPro
cyclin-dependent protein serine/threonine kinase activity	GO:0004693	IEA:EnsemblFungi

GO - Biological Process
positive regulation of transcription by RNA polymerase II	GO:0045944	IEA:EnsemblFungi









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP04197
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      67.22|      17|      19|     414|     430|       1
---------------------------------------------------------------------------
  414-  430 (34.20/24.97)	RVTHEDNGDPKMGSLPP
  436-  452 (33.01/23.82)	RLPSSSNFRPATGSLPP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      43.83|      10|      15|     327|     336|       2
---------------------------------------------------------------------------
  327-  336 (22.73/13.32)	WPGVVNMPEW
  345-  354 (21.10/11.87)	YPTASPLPTW
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|      81.45|      18|      19|     223|     240|       3
---------------------------------------------------------------------------
  183-  196 (15.75/ 8.03)	....IPPTTLRRLLHQ.LL
  205-  218 (15.98/ 8.27)	QFVMHRDLKPANIL.....
  223-  240 (32.30/25.82)	GVVKIGDLGLARLWHK.PL
  244-  260 (17.42/ 9.82)	GLYG.GDKVVVTIWYRaP.
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP04197 with CDK8 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) YPHRRVTHEDNGDPKMGSLPPSLAGGRLPSSSNFRPATGSLPPAKRTRLAR
410
460










Molecular Recognition Features






MoRF SequenceStartStop




NANANA