<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04187
| Description |
Uncharacterized protein |
| Sequence | MSDADPLDLTSLDTDSLLRALAAVQKAVPDLLLDVKPVLAHLTSPTEEADEEGATAARDAVERYMATVDKIQFILRQSVFFLRETRAAPSVLRPPPPDALPRPLAATLRDSGGGDGEAQLGLYALRVEVATLKDMLAAVKASRGAGEGEGAAVGEGQEKEEAMEMA |
| Length | 166 |
| Position | Head |
| Organism | Cutaneotrichosporon oleaginosum |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Tremellomycetes>
Trichosporonales> Trichosporonaceae> Cutaneotrichosporon.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.130 |
| Instability index | 45.18 |
| Isoelectric point | 4.49 |
| Molecular weight | 17509.63 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP04187
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 73.01| 22| 30| 100| 121| 2
---------------------------------------------------------------------------
100- 121 (40.12/22.15) LPRPLAATLRDSGGGDGE.AQLG
132- 154 (32.89/17.01) LKDMLAAVKASRGAGEGEgAAVG
---------------------------------------------------------------------------
|